Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039753738-09696-29604 Query= (336 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039753738-09696-29604
Query= (336 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|17547522|ref|NP_520924.1| HYPOTHETICAL PROTEIN [Ralstoni... 32 1.8 gi|21758113|dbj|BAC05246.1| unnamed protein product [Homo s... 31 4.1 gi|23007889|gb|ZP_00049566.1| hypothetical protein [Magneto... 30 9.2 gi|23508014|ref|NP_700684.1| hypothetical protein [Plasmodi... 30 9.2 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|17547522|ref|NP_520924.1| HYPOTHETICAL PROTEIN [Ralstoni... 32 1.8 gi|21758113|dbj|BAC05246.1| unnamed protein product [Homo s... 31 4.1 gi|23007889|gb|ZP_00049566.1| hypothetical protein [Magneto... 30 9.2 gi|23508014|ref|NP_700684.1| hypothetical protein [Plasmodi... 30 9.2
>gi|17547522|ref|NP_520924.1| HYPOTHETICAL PROTEIN [Ralstonia solanacearum] gi|17429826|emb|CAD16510.1| HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 362 Score = 32.0 bits (71), Expect = 1.8 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = +2 Query: 104 QFAVPKFFFYYFGVRCASPSEACRLLERYL----QLAW 205 Q+A+P FY G C S ++AC +L R+ +LAW Sbjct: 184 QYAIPDGMFYGGGATCWSTAQACAILSRHAADAPRLAW 221
>gi|21758113|dbj|BAC05246.1| unnamed protein product [Homo sapiens] Length = 180 Score = 30.8 bits (68), Expect = 4.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 80 FNQTHVYSQFAVPKFFFYYF 139 FNQ H+ SQF + +F+YYF Sbjct: 28 FNQAHLVSQFIILFYFYYYF 47
>gi|23007889|gb|ZP_00049566.1| hypothetical protein [Magnetospirillum magnetotacticum] Length = 328 Score = 29.6 bits (65), Expect = 9.2 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -3 Query: 157 RSTSDTKIIKKKLRHCKL*IHMCLVKNH 74 R+T DT++++K L C+L +H+ NH Sbjct: 182 RATPDTRLVEKALSGCELTVHIATKLNH 209
>gi|23508014|ref|NP_700684.1| hypothetical protein [Plasmodium falciparum 3D7] gi|23495076|gb|AAN35408.1|AE014832_30 hypothetical protein [Plasmodium falciparum 3D7] Length = 4431 Score = 29.6 bits (65), Expect = 9.2 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +2 Query: 11 DLIYHLISHRREQKPCYTTDLVIFNQTHVYSQFAVPKFFFYYFGV 145 D ++ + + + E+K +V+FN Y++F + K F+YY + Sbjct: 3939 DNVFLIFNKKYERKK-----VVVFNNIEEYNKFNITKLFYYYISI 3978
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 232,322,093 Number of Sequences: 1247039 Number of extensions: 4074626 Number of successful extensions: 7856 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 7747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7855 length of database: 397,579,747 effective HSP length: 87 effective length of database: 289,087,354 effective search space used: 6938096496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)