Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039751907-024587-31837 Query= (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039751907-024587-31837
Query= (358 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|14140146|emb|CAC39063.1| putative protein [Oryza sativa] 92 1e-38 gi|18423248|ref|NP_568754.1| putative protein; protein id: ... 84 3e-16 gi|8843854|dbj|BAA97380.1| gene_id:MWD22.12~pir||T00623~sim... 83 7e-16 gi|7487492|pir||T00623 hypothetical protein T27I1.6 - Arabi... 64 3e-10 gi|15218376|ref|NP_172475.1| unknown protein; protein id: A... 64 3e-10 gi|15218842|ref|NP_174208.1| hypothetical protein; protein ... 52 2e-06 gi|20260538|gb|AAM13167.1| unknown protein [Arabidopsis tha... 50 5e-06 gi|1633516|pdb|1ROD|A Chain A, Chimeric Protein Of Interleu... 34 0.47 gi|20839268|ref|XP_145801.1| similar to olfactory receptor ... 28 2.2 gi|12641915|gb|AAK00048.1| interleukin 8 C-terminal variant... 31 3.1 gi|10834978|ref|NP_000575.1| interleukin 8 [Homo sapiens] >... 31 4.0 gi|15208453|gb|AAK91815.1|AF272752_1 kinesin heavy chain [Z... 31 4.0 gi|22043541|ref|XP_170504.1| similar to interleukin 8 [Homo... 31 4.0 gi|1942192|pdb|1ICW|A Chain A, Interleukin-8, Mutant With G... 31 4.0 gi|4139539|pdb|1ILP|A Chain A, Cxcr-1 N-Terminal Peptide Bo... 31 4.0 gi|7546436|pdb|1QE6|D Chain D, Interleukin-8 With An Added ... 31 4.0 gi|535769|gb|AAA74722.1| neutrophil-activating factor >gi|1... 31 4.0 gi|33959|emb|CAA77745.1| interleukin 8 [Homo sapiens] 31 4.0 gi|1708456|sp|P51495|IL8_MACMU Interleukin-8 precursor (IL-... 30 5.2 gi|1170542|sp|P46653|IL8_CERTO Interleukin-8 precursor (IL-... 30 8.9 gi|9629499|ref|NP_056907.1| gag-pro-pol polyprotein [Simian... 30 8.9 Alignments
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|14140146|emb|CAC39063.1| putative protein [Oryza sativa] 92 1e-38 gi|18423248|ref|NP_568754.1| putative protein; protein id: ... 84 3e-16 gi|8843854|dbj|BAA97380.1| gene_id:MWD22.12~pir||T00623~sim... 83 7e-16 gi|7487492|pir||T00623 hypothetical protein T27I1.6 - Arabi... 64 3e-10 gi|15218376|ref|NP_172475.1| unknown protein; protein id: A... 64 3e-10 gi|15218842|ref|NP_174208.1| hypothetical protein; protein ... 52 2e-06 gi|20260538|gb|AAM13167.1| unknown protein [Arabidopsis tha... 50 5e-06 gi|1633516|pdb|1ROD|A Chain A, Chimeric Protein Of Interleu... 34 0.47 gi|20839268|ref|XP_145801.1| similar to olfactory receptor ... 28 2.2 gi|12641915|gb|AAK00048.1| interleukin 8 C-terminal variant... 31 3.1 gi|10834978|ref|NP_000575.1| interleukin 8 [Homo sapiens] >... 31 4.0 gi|15208453|gb|AAK91815.1|AF272752_1 kinesin heavy chain [Z... 31 4.0 gi|22043541|ref|XP_170504.1| similar to interleukin 8 [Homo... 31 4.0 gi|1942192|pdb|1ICW|A Chain A, Interleukin-8, Mutant With G... 31 4.0 gi|4139539|pdb|1ILP|A Chain A, Cxcr-1 N-Terminal Peptide Bo... 31 4.0 gi|7546436|pdb|1QE6|D Chain D, Interleukin-8 With An Added ... 31 4.0 gi|535769|gb|AAA74722.1| neutrophil-activating factor >gi|1... 31 4.0 gi|33959|emb|CAA77745.1| interleukin 8 [Homo sapiens] 31 4.0 gi|1708456|sp|P51495|IL8_MACMU Interleukin-8 precursor (IL-... 30 5.2 gi|1170542|sp|P46653|IL8_CERTO Interleukin-8 precursor (IL-... 30 8.9 gi|9629499|ref|NP_056907.1| gag-pro-pol polyprotein [Simian... 30 8.9
>gi|14140146|emb|CAC39063.1| putative protein [Oryza sativa] Length = 346 Score = 91.7 bits (226), Expect(2) = 1e-38 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 358 TDVADVDSCMLEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQ 224 TDVADVDSCMLEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQ Sbjct: 239 TDVADVDSCMLEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQ 283
Score = 88.2 bits (217), Expect(2) = 1e-38 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 200 RRCRCHKPYDRPFRPIVKQLRYLEASLSEERQLLTADLPSL 78 RRCRCHKPYDRPFRPIVKQLRYLEASLSEERQLLTADLPSL Sbjct: 284 RRCRCHKPYDRPFRPIVKQLRYLEASLSEERQLLTADLPSL 324
>gi|18423248|ref|NP_568754.1| putative protein; protein id: At5g51180.1, supported by cDNA: gi_15292882, supported by cDNA: gi_20258912 [Arabidopsis thaliana] gi|15292883|gb|AAK92812.1| unknown protein [Arabidopsis thaliana] gi|20258913|gb|AAM14150.1| unknown protein [Arabidopsis thaliana] Length = 357 Score = 84.3 bits (207), Expect = 3e-16 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -1 Query: 328 LEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQVKDPVMHSEGADVINHMIDHF 161 +EE +++GL VSWEKVDVSFH+S+ R AAHSVIQVK+ MH EGADVI H+IDHF Sbjct: 300 IEEEMIKGLSSVSWEKVDVSFHSSRQRFAAHSVIQVKNEDMHIEGADVIEHIIDHF 355
>gi|8843854|dbj|BAA97380.1| gene_id:MWD22.12~pir||T00623~similar to unknown protein [Arabidopsis thaliana] Length = 360 Score = 83.2 bits (204), Expect = 7e-16 Identities = 39/62 (62%), Positives = 48/62 (77%) Frame = -1 Query: 346 DVDSCMLEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQVKDPVMHSEGADVINHMID 167 D++ E +++GL VSWEKVDVSFH+S+ R AAHSVIQVK+ MH EGADVI H+ID Sbjct: 297 DIEVVNCAEEMIKGLSSVSWEKVDVSFHSSRQRFAAHSVIQVKNEDMHIEGADVIEHIID 356 Query: 166 HF 161 HF Sbjct: 357 HF 358
>gi|7487492|pir||T00623 hypothetical protein T27I1.6 - Arabidopsis thaliana gi|3540182|gb|AAC34332.1| Unknown protein [Arabidopsis thaliana] Length = 402 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -1 Query: 328 LEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQVKDPVMHSEGADVINHMIDHF 161 +EE ++R L +SWE+VDVSF + R AH+ IQVK +++S GADVI HMID+F Sbjct: 345 MEEEMIRELTKLSWERVDVSFRGTLQRFLAHNTIQVKTKMINSAGADVIQHMIDNF 400
>gi|15218376|ref|NP_172475.1| unknown protein; protein id: At1g10040.1 [Arabidopsis thaliana] Length = 379 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -1 Query: 328 LEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQVKDPVMHSEGADVINHMIDHF 161 +EE ++R L +SWE+VDVSF + R AH+ IQVK +++S GADVI HMID+F Sbjct: 322 MEEEMIRELTKLSWERVDVSFRGTLQRFLAHNTIQVKTKMINSAGADVIQHMIDNF 377
>gi|15218842|ref|NP_174208.1| hypothetical protein; protein id: At1g29130.1 [Arabidopsis thaliana] gi|25518124|pir||G86413 F28N24.17 protein - Arabidopsis thaliana gi|9502425|gb|AAF88124.1|AC021043_17 Unknown protein [Arabidopsis thaliana] Length = 140 Score = 51.6 bits (122), Expect = 2e-06 Identities = 24/55 (43%), Positives = 37/55 (67%) Frame = -1 Query: 331 MLEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQVKDPVMHSEGADVINHMID 167 ++EE ++RGL+ + W+KVDVSFH++ AH+ I VK ++ GA VI H+ D Sbjct: 71 IVEEEMIRGLQRLGWKKVDVSFHSTFWPYLAHNNIHVKSERLYKAGAGVIAHVAD 125
>gi|20260538|gb|AAM13167.1| unknown protein [Arabidopsis thaliana] Length = 455 Score = 50.4 bits (119), Expect = 5e-06 Identities = 24/55 (43%), Positives = 36/55 (65%) Frame = -1 Query: 331 MLEERLLRGLKLVSWEKVDVSFHNSKVRSAAHSVIQVKDPVMHSEGADVINHMID 167 ++EE ++RGL+ + W+KVDVSFH++ AH+ I VK + GA VI H+ D Sbjct: 386 IVEEEMIRGLQRLGWKKVDVSFHSTFWPYLAHNNIHVKSERLFKAGAGVIAHVAD 440
>gi|1633516|pdb|1ROD|A Chain A, Chimeric Protein Of Interleukin 8 And Human Melanoma Growth Stimulating Activity Protein, Nmr gi|1633517|pdb|1ROD|B Chain B, Chimeric Protein Of Interleukin 8 And Human Melanoma Growth Stimulating Activity Protein, Nmr Length = 72 Score = 33.9 bits (76), Expect = 0.47 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 12/59 (20%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA-----------SLSEERQLLTADLPSLVSKFIAK 57 RC+C K Y +PF P +K+LR +E+ LS+ R+L +V K I K Sbjct: 6 RCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPASPIVKKIIEK 64
>gi|20839268|ref|XP_145801.1| similar to olfactory receptor MOR4-1 [Mus musculus] Length = 315 Score = 28.5 bits (62), Expect(2) = 2.2 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 253 LCCCGS*HPPFPTTQASDLLKAVLLTCSCPHRQH 354 LCC G HP + S L +A L + S PH QH Sbjct: 240 LCCFGFLHPHHWSDYGSPLWEASLSSGSGPHGQH 273
Score = 21.9 bits (45), Expect(2) = 2.2 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Frame = +2 Query: 56 ILR*TCSPGSANQQLATDVPRSSLLLDIGAVLL*DEMVDHMVYDIGTFAMHNGIFD---L 226 ++R CS N A V +LLLD +L M+ H V I + +F + Sbjct: 178 LIRMACSDICFNSFYAPSVVICTLLLDAVLILASYVMILHTVLSIASREERMQVFANMCI 237 Query: 227 NHTMCC 244 +H +CC Sbjct: 238 SH-LCC 242
>gi|12641915|gb|AAK00048.1| interleukin 8 C-terminal variant [Homo sapiens] Length = 102 Score = 31.2 bits (69), Expect = 3.1 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 12/60 (20%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA-----------SLSEERQLLTADLPSLVSKFIAKS 54 RC+C K Y +PF P +K+LR +E+ LS+ R+L + V + + K+ Sbjct: 33 RCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKA 92
>gi|10834978|ref|NP_000575.1| interleukin 8 [Homo sapiens] gi|124359|sp|P10145|IL8_HUMAN Interleukin-8 precursor (IL-8) (CXCL8) (Monocyte-derived neutrophil chemotactic factor) (MDNCF) (T-cell chemotactic factor) (Neutrophil-activating protein 1) (NAP-1) (Lymphocyte-derived neutrophil-activating factor) (LYNAP) (Protein 3-10C) (Neutrophil-activating factor) (NAF) (Granulocyte chemotactic protein 1) (GCP-1) (Emoctakin) gi|88001|pir||A37034 interleukin-8 precursor - human gi|34519|emb|CAA68742.1| MDNCF precursor (AA -27 to 72) [Homo sapiens] gi|179580|gb|AAA35611.1| beta-thromboglobulin-like protein precursor gi|186368|gb|AAA59158.1| interleukin 8 gi|188628|gb|AAA36323.1| monocyte-derived neutrophil-activating protein precursor gi|219916|dbj|BAA03245.1| LUCT/interleukin-8 [Homo sapiens] gi|15488984|gb|AAH13615.1|AAH13615 interleukin 8 [Homo sapiens] Length = 99 Score = 30.8 bits (68), Expect = 4.0 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC+C K Y +PF P +K+LR +E+ Sbjct: 33 RCQCIKTYSKPFHPKFIKELRVIES 57
>gi|15208453|gb|AAK91815.1|AF272752_1 kinesin heavy chain [Zea mays] Length = 992 Score = 30.8 bits (68), Expect = 4.0 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -3 Query: 146 QLRYLEASLSEERQLLTADLPSLVSKFIAKSR 51 Q+ Y E S SEE++LL AD+ SLVSK I + R Sbjct: 764 QMVYEEQSKSEEQKLL-ADISSLVSKHITRQR 794
>gi|22043541|ref|XP_170504.1| similar to interleukin 8 [Homo sapiens] gi|14326461|gb|AAK60276.1|AF385628_1 interleukin 8 [Homo sapiens] Length = 67 Score = 30.8 bits (68), Expect = 4.0 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC+C K Y +PF P +K+LR +E+ Sbjct: 33 RCQCIKTYSKPFHPKFIKELRVIES 57
>gi|1942192|pdb|1ICW|A Chain A, Interleukin-8, Mutant With Glu 38 Replaced By Cys And Cys 50 Replaced By Ala gi|1942193|pdb|1ICW|B Chain B, Interleukin-8, Mutant With Glu 38 Replaced By Cys And Cys 50 Replaced By Ala Length = 72 Score = 30.8 bits (68), Expect = 4.0 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC+C K Y +PF P +K+LR +E+ Sbjct: 6 RCQCIKTYSKPFHPKFIKELRVIES 30
>gi|4139539|pdb|1ILP|A Chain A, Cxcr-1 N-Terminal Peptide Bound To Interleukin-8 gi|4139540|pdb|1ILP|B Chain B, Cxcr-1 N-Terminal Peptide Bound To Interleukin-8 gi|4139542|pdb|1ILQ|A Chain A, Cxcr-1 N-Terminal Peptide Bound To Interleukin-8 (Minimized Mean) gi|4139543|pdb|1ILQ|B Chain B, Cxcr-1 N-Terminal Peptide Bound To Interleukin-8 (Minimized Mean) gi|230035|pdb|1IL8|A Chain A, Interleukin 8 (Il-8) (Neutrophil Activation Protein) NAP (NMR, Minimized Mean Structure) gi|230036|pdb|1IL8|B Chain B, Interleukin 8 (Il-8) (Neutrophil Activation Protein) NAP (NMR, Minimized Mean Structure) gi|230587|pdb|2IL8|A Chain A, Interleukin 8 (Il-8) (Neutrophil Activation Protein) NAP (NMR,41 Simulated Annealing Structures) gi|230588|pdb|2IL8|B Chain B, Interleukin 8 (Il-8) (Neutrophil Activation Protein) NAP (NMR,41 Simulated Annealing Structures) gi|1311337|pdb|1IKL| Nmr Study Of Monomeric Human Interleukin-8 (Minimized Average Structure) gi|1311336|pdb|1IKM| Nmr Study Of Monomeric Human Interleukin-8 (30 Structures) gi|230886|pdb|3IL8| Interleukin 8 Length = 72 Score = 30.8 bits (68), Expect = 4.0 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC+C K Y +PF P +K+LR +E+ Sbjct: 6 RCQCIKTYSKPFHPKFIKELRVIES 30
>gi|7546436|pdb|1QE6|D Chain D, Interleukin-8 With An Added Disulfide Between Residues 5 And 33 (L5cH33C) gi|7546434|pdb|1QE6|B Chain B, Interleukin-8 With An Added Disulfide Between Residues 5 And 33 (L5cH33C) gi|7546433|pdb|1QE6|A Chain A, Interleukin-8 With An Added Disulfide Between Residues 5 And 33 (L5cH33C) gi|7546435|pdb|1QE6|C Chain C, Interleukin-8 With An Added Disulfide Between Residues 5 And 33 (L5cH33C) Length = 72 Score = 30.8 bits (68), Expect = 4.0 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC+C K Y +PF P +K+LR +E+ Sbjct: 6 RCQCIKTYSKPFHPKFIKELRVIES 30
>gi|535769|gb|AAA74722.1| neutrophil-activating factor gi|1314781|gb|AAB01177.1| interleukin-8 Length = 73 Score = 30.8 bits (68), Expect = 4.0 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC+C K Y +PF P +K+LR +E+ Sbjct: 7 RCQCIKTYSKPFHPKFIKELRVIES 31
>gi|33959|emb|CAA77745.1| interleukin 8 [Homo sapiens] Length = 97 Score = 30.8 bits (68), Expect = 4.0 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC+C K Y +PF P +K+LR +E+ Sbjct: 33 RCQCIKTYSKPFHPKFIKELRVIES 57
>gi|1708456|sp|P51495|IL8_MACMU Interleukin-8 precursor (IL-8) (CXCL8) gi|644816|gb|AAA86711.1| interleukin-8 gi|644820|gb|AAA86713.1| interleukin-8 gi|9313023|gb|AAA80141.2| interleukin-8; IL-8 [Macaca mulatta] Length = 101 Score = 30.4 bits (67), Expect = 5.2 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC C K Y +PF P +K+LR +E+ Sbjct: 33 RCECIKTYSKPFHPKFIKELRVIES 57
>gi|1170542|sp|P46653|IL8_CERTO Interleukin-8 precursor (IL-8) (CXCL8) gi|644796|gb|AAA86705.1| interleukin-8 Length = 101 Score = 29.6 bits (65), Expect = 8.9 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 197 RCRCHKPYDRPFRP-IVKQLRYLEA 126 RC C K Y +PF P +K+LR +E+ Sbjct: 33 RCLCIKTYSKPFHPKFIKELRVIES 57
>gi|9629499|ref|NP_056907.1| gag-pro-pol polyprotein [Simian T-lymphotropic virus 2] gi|3097273|emb|CAA74901.1| gag-pro-pol polyprotein [Simian T-lymphotropic virus 2] Length = 1468 Score = 29.6 bits (65), Expect = 8.9 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +3 Query: 138 SELFYYRTKWSIIWFMTSAP--SLCITGSLT*ITLCAADLTLL--LWKLTSTFSHDTS 299 S LF R +W ++W T P SLC G L T+ D L +L +F H+ S Sbjct: 915 SVLFQARQRWPLVWLHTPHPPTSLCPWGHLLACTILTLDKYSLQHYGQLCQSFHHNMS 972
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 255,542,464 Number of Sequences: 1247039 Number of extensions: 4692876 Number of successful extensions: 11169 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 10986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11167 length of database: 397,579,747 effective HSP length: 94 effective length of database: 280,358,081 effective search space used: 6728593944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
