Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039751170-018212-12074 Query= (271 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039751170-018212-12074
Query= (271 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|259138|gb|AAB24011.1| oryzacystatin=cysteine protease in... 71 3e-12 gi|118170|sp|P09229|CYT1_ORYSA CYSTEINE PROTEINASE INHIBITO... 71 3e-12 gi|1076797|pir||S54828 cysteine proteinase inhibitor precur... 60 9e-09 gi|2118423|pir||JC4882 cystatin - maize >gi|1498133|dbj|BAA... 58 3e-08 gi|2130095|pir||PC6025 cysteine proteinase inhibitor - sorg... 58 3e-08 gi|1008922|dbj|BAA07327.1| cystatin II [Zea mays] 57 4e-08 gi|1076795|pir||JC4007 cystatin II - maize 57 4e-08 gi|399334|sp|P31726|CYT1_MAIZE Cystatin I precursor (CORN k... 57 6e-08 gi|11559283|dbj|BAB18768.1| cysteine proteinase inhibitor [... 57 6e-08 gi|12657579|dbj|BAB21558.1| cystatin [Coix lacryma-jobi] 55 2e-07 gi|11559285|dbj|BAB18769.1| cysteine proteinase inhibitor [... 55 2e-07 gi|168556|gb|AAA18557.1| putative. similar to cystatins 55 2e-07 gi|1706276|sp|Q10992|CYTA_HELAN Cysteine proteinase inhibit... 54 4e-07 gi|18399630|ref|NP_566425.1| cysteine proteinase inhibitor,... 54 4e-07 gi|12321971|gb|AAG51028.1|AC069474_27 cysteine proteinase i... 54 4e-07 gi|11358954|pir||JC7333 multicystatin - common sunflower >g... 54 5e-07 gi|24899735|gb|AAN65082.1| cysteine proteinase inhibitor, p... 53 8e-07 gi|100671|pir||S13027 cysteine proteinase inhibitor - rice ... 52 2e-06 gi|18158608|gb|AAL59842.1| cysteine protease inhibitor CPI-... 52 2e-06 gi|7488521|pir||T14386 cysteine proteinase inhibitor BCPI-2... 52 2e-06 gi|11139270|gb|AAG31653.1| PRLI-interacting factor M [Arabi... 52 2e-06 gi|2129783|pir||S65071 cystatin - field mustard >gi|762785|... 52 2e-06 gi|7488657|pir||T07139 cysteine proteinase inhibitor - soyb... 52 2e-06 gi|1169196|sp|Q06445|CYTI_VIGUN CYSTEINE PROTEINASE INHIBIT... 52 2e-06 gi|8099682|gb|AAF72202.1|AF265551_1 cysteine protease inhib... 51 3e-06 gi|13183179|gb|AAK15090.1|AF240007_1 cystatin [Sesamum indi... 51 3e-06 gi|18030077|gb|AAL56612.1|AF454396_1 cystatin [Vigna radiata] 51 4e-06 gi|6671192|gb|AAF23126.1|AF198388_1 cystatin [Lycopersicon ... 50 5e-06 gi|25392144|pir||JC7636 cystatin 1 - wheat >gi|11559279|dbj... 50 7e-06 gi|9650760|emb|CAA72790.1| cysteine proteinase inhibitor [H... 50 7e-06 gi|13603389|gb|AAK30004.1| cysteine proteinase inhibitor [D... 49 2e-05 gi|4150974|emb|CAA11899.1| cystatin [Castanea sativa] 49 2e-05 gi|2317876|gb|AAB71505.1| cysteine protease inhibitor [Pyru... 49 2e-05 gi|6721552|dbj|BAA89582.1| unnamed protein product [Oryza s... 49 2e-05 gi|15238418|ref|NP_196130.1| cysteine proteinase inhibitor-... 49 2e-05 gi|118171|sp|P20907|CYT2_ORYSA CYSTEINE PROTEINASE INHIBITO... 49 2e-05 gi|21555194|gb|AAM63801.1| cysteine proteinase inhibitor-li... 49 2e-05 gi|1076243|pir||JH0269 cystatin - avocado >gi|1586085|prf||... 48 3e-05 gi|7488895|pir||T10057 cysteine proteinase inhibitor (clone... 48 3e-05 gi|18874516|gb|AAL79831.1|AF469485_1 cystatin [Sandersonia ... 48 4e-05 gi|7438238|pir||T07051 cysteine proteinase inhibitor - soyb... 47 6e-05 gi|7488656|pir||T07054 cysteine proteinase inhibitor (clone... 47 8e-05 gi|18307510|emb|CAD21441.1| putative cysteine proteinase in... 47 8e-05 gi|7595872|gb|AAF64480.1|AF241536_1 cysteine protease inhib... 45 2e-04 gi|4261517|gb|AAD13812.1| cysteine proteinase inhibitor [Ip... 45 2e-04 gi|6671194|gb|AAF23127.1|AF198389_1 cystatin [Lycopersicon ... 44 5e-04 gi|4929216|gb|AAD33907.1|AF143677_1 cysteine proteinase inh... 44 7e-04 gi|11127597|dbj|BAB17683.1| cysteine proteinase inhibitor h... 43 0.001 gi|19347961|gb|AAL86314.1| putative cysteine proteinase inh... 43 0.001 gi|15226769|ref|NP_181620.1| putative cysteine proteinase i... 43 0.001 gi|25392145|pir||JC7637 cystatin 4 - wheat >gi|11559281|dbj... 42 0.002 gi|7488658|pir||T07053 cysteine proteinase inhibitor - soyb... 41 0.004 gi|585033|sp|P37842|CYTM_SOLTU Multicystatin precursor (MC)... 40 0.006 gi|11559277|dbj|BAB18765.1| cysteine proteinase inhibitor [... 40 0.007 gi|544133|sp|Q03196|CYT_SOLTU CYSTEINE PROTEINASE INHIBITOR... 40 0.010 gi|543520|pir||JN0906 cystatin proteinase-inhibitor - commo... 40 0.010 gi|22001329|gb|AAM88397.1|AF525880_1 cysteine proteinase in... 40 0.010 gi|6671196|gb|AAF23128.1|AF198390_1 multicystatin; cystatin... 40 0.010 gi|7488982|pir||T06323 cysteine proteinase inhibitor, methy... 40 0.010 gi|14329794|emb|CAC40744.1| putative multicystatin precurso... 39 0.017 gi|3808239|gb|AAC69278.1| cysteine proteinase inhibitor [Di... 38 0.028 gi|11596186|gb|AAG38521.1|AF283536_1 cystatin-like protein ... 38 0.037 gi|21592712|gb|AAM64661.1| cystatin-like protein [Arabidops... 34 0.41 gi|15238128|ref|NP_199566.1| putative protein; protein id: ... 34 0.41 gi|7488520|pir||T14388 cysteine proteinase inhibitor - turn... 33 1.2 gi|17538704|ref|NP_499958.1| C18H7.2.p [Caenorhabditis eleg... 32 2.6 gi|25148229|ref|NP_741294.1| Innexin family member (50.5 kD... 32 2.6 gi|25148232|ref|NP_741295.1| Innexin family member (47.7 kD... 32 2.6 gi|17541292|ref|NP_500915.1| Cysteine protease inhibitor Cy... 32 2.6 gi|18310878|ref|NP_562812.1| hypothetical protein [Clostrid... 31 3.5 gi|17562818|ref|NP_504565.1| Cystatin-type cysteine protein... 31 3.5 gi|1363477|pir||JC4259 cystatin - papaya >gi|311505|emb|CAA... 31 3.5 gi|21297766|gb|EAA09911.1| agCP11809 [Anopheles gambiae str... 30 5.9 gi|15239883|ref|NP_196775.1| cystatin (emb|CAA03929.1); pro... 30 5.9 gi|15724168|gb|AAL06476.1|AF411786_1 AT5g12140/MXC9_10 [Ara... 30 5.9 Alignments
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|259138|gb|AAB24011.1| oryzacystatin=cysteine protease in... 71 3e-12 gi|118170|sp|P09229|CYT1_ORYSA CYSTEINE PROTEINASE INHIBITO... 71 3e-12 gi|1076797|pir||S54828 cysteine proteinase inhibitor precur... 60 9e-09 gi|2118423|pir||JC4882 cystatin - maize >gi|1498133|dbj|BAA... 58 3e-08 gi|2130095|pir||PC6025 cysteine proteinase inhibitor - sorg... 58 3e-08 gi|1008922|dbj|BAA07327.1| cystatin II [Zea mays] 57 4e-08 gi|1076795|pir||JC4007 cystatin II - maize 57 4e-08 gi|399334|sp|P31726|CYT1_MAIZE Cystatin I precursor (CORN k... 57 6e-08 gi|11559283|dbj|BAB18768.1| cysteine proteinase inhibitor [... 57 6e-08 gi|12657579|dbj|BAB21558.1| cystatin [Coix lacryma-jobi] 55 2e-07 gi|11559285|dbj|BAB18769.1| cysteine proteinase inhibitor [... 55 2e-07 gi|168556|gb|AAA18557.1| putative. similar to cystatins 55 2e-07 gi|1706276|sp|Q10992|CYTA_HELAN Cysteine proteinase inhibit... 54 4e-07 gi|18399630|ref|NP_566425.1| cysteine proteinase inhibitor,... 54 4e-07 gi|12321971|gb|AAG51028.1|AC069474_27 cysteine proteinase i... 54 4e-07 gi|11358954|pir||JC7333 multicystatin - common sunflower >g... 54 5e-07 gi|24899735|gb|AAN65082.1| cysteine proteinase inhibitor, p... 53 8e-07 gi|100671|pir||S13027 cysteine proteinase inhibitor - rice ... 52 2e-06 gi|18158608|gb|AAL59842.1| cysteine protease inhibitor CPI-... 52 2e-06 gi|7488521|pir||T14386 cysteine proteinase inhibitor BCPI-2... 52 2e-06 gi|11139270|gb|AAG31653.1| PRLI-interacting factor M [Arabi... 52 2e-06 gi|2129783|pir||S65071 cystatin - field mustard >gi|762785|... 52 2e-06 gi|7488657|pir||T07139 cysteine proteinase inhibitor - soyb... 52 2e-06 gi|1169196|sp|Q06445|CYTI_VIGUN CYSTEINE PROTEINASE INHIBIT... 52 2e-06 gi|8099682|gb|AAF72202.1|AF265551_1 cysteine protease inhib... 51 3e-06 gi|13183179|gb|AAK15090.1|AF240007_1 cystatin [Sesamum indi... 51 3e-06 gi|18030077|gb|AAL56612.1|AF454396_1 cystatin [Vigna radiata] 51 4e-06 gi|6671192|gb|AAF23126.1|AF198388_1 cystatin [Lycopersicon ... 50 5e-06 gi|25392144|pir||JC7636 cystatin 1 - wheat >gi|11559279|dbj... 50 7e-06 gi|9650760|emb|CAA72790.1| cysteine proteinase inhibitor [H... 50 7e-06 gi|13603389|gb|AAK30004.1| cysteine proteinase inhibitor [D... 49 2e-05 gi|4150974|emb|CAA11899.1| cystatin [Castanea sativa] 49 2e-05 gi|2317876|gb|AAB71505.1| cysteine protease inhibitor [Pyru... 49 2e-05 gi|6721552|dbj|BAA89582.1| unnamed protein product [Oryza s... 49 2e-05 gi|15238418|ref|NP_196130.1| cysteine proteinase inhibitor-... 49 2e-05 gi|118171|sp|P20907|CYT2_ORYSA CYSTEINE PROTEINASE INHIBITO... 49 2e-05 gi|21555194|gb|AAM63801.1| cysteine proteinase inhibitor-li... 49 2e-05 gi|1076243|pir||JH0269 cystatin - avocado >gi|1586085|prf||... 48 3e-05 gi|7488895|pir||T10057 cysteine proteinase inhibitor (clone... 48 3e-05 gi|18874516|gb|AAL79831.1|AF469485_1 cystatin [Sandersonia ... 48 4e-05 gi|7438238|pir||T07051 cysteine proteinase inhibitor - soyb... 47 6e-05 gi|7488656|pir||T07054 cysteine proteinase inhibitor (clone... 47 8e-05 gi|18307510|emb|CAD21441.1| putative cysteine proteinase in... 47 8e-05 gi|7595872|gb|AAF64480.1|AF241536_1 cysteine protease inhib... 45 2e-04 gi|4261517|gb|AAD13812.1| cysteine proteinase inhibitor [Ip... 45 2e-04 gi|6671194|gb|AAF23127.1|AF198389_1 cystatin [Lycopersicon ... 44 5e-04 gi|4929216|gb|AAD33907.1|AF143677_1 cysteine proteinase inh... 44 7e-04 gi|11127597|dbj|BAB17683.1| cysteine proteinase inhibitor h... 43 0.001 gi|19347961|gb|AAL86314.1| putative cysteine proteinase inh... 43 0.001 gi|15226769|ref|NP_181620.1| putative cysteine proteinase i... 43 0.001 gi|25392145|pir||JC7637 cystatin 4 - wheat >gi|11559281|dbj... 42 0.002 gi|7488658|pir||T07053 cysteine proteinase inhibitor - soyb... 41 0.004 gi|585033|sp|P37842|CYTM_SOLTU Multicystatin precursor (MC)... 40 0.006 gi|11559277|dbj|BAB18765.1| cysteine proteinase inhibitor [... 40 0.007 gi|544133|sp|Q03196|CYT_SOLTU CYSTEINE PROTEINASE INHIBITOR... 40 0.010 gi|543520|pir||JN0906 cystatin proteinase-inhibitor - commo... 40 0.010 gi|22001329|gb|AAM88397.1|AF525880_1 cysteine proteinase in... 40 0.010 gi|6671196|gb|AAF23128.1|AF198390_1 multicystatin; cystatin... 40 0.010 gi|7488982|pir||T06323 cysteine proteinase inhibitor, methy... 40 0.010 gi|14329794|emb|CAC40744.1| putative multicystatin precurso... 39 0.017 gi|3808239|gb|AAC69278.1| cysteine proteinase inhibitor [Di... 38 0.028 gi|11596186|gb|AAG38521.1|AF283536_1 cystatin-like protein ... 38 0.037 gi|21592712|gb|AAM64661.1| cystatin-like protein [Arabidops... 34 0.41 gi|15238128|ref|NP_199566.1| putative protein; protein id: ... 34 0.41 gi|7488520|pir||T14388 cysteine proteinase inhibitor - turn... 33 1.2 gi|17538704|ref|NP_499958.1| C18H7.2.p [Caenorhabditis eleg... 32 2.6 gi|25148229|ref|NP_741294.1| Innexin family member (50.5 kD... 32 2.6 gi|25148232|ref|NP_741295.1| Innexin family member (47.7 kD... 32 2.6 gi|17541292|ref|NP_500915.1| Cysteine protease inhibitor Cy... 32 2.6 gi|18310878|ref|NP_562812.1| hypothetical protein [Clostrid... 31 3.5 gi|17562818|ref|NP_504565.1| Cystatin-type cysteine protein... 31 3.5 gi|1363477|pir||JC4259 cystatin - papaya >gi|311505|emb|CAA... 31 3.5 gi|21297766|gb|EAA09911.1| agCP11809 [Anopheles gambiae str... 30 5.9 gi|15239883|ref|NP_196775.1| cystatin (emb|CAA03929.1); pro... 30 5.9 gi|15724168|gb|AAL06476.1|AF411786_1 AT5g12140/MXC9_10 [Ara... 30 5.9
>gi|259138|gb|AAB24011.1| oryzacystatin=cysteine protease inhibitor [Oryza=rice, Peptide Recombinant, 90 aa] Length = 90 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 270 AKKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 AKKLYEAKVWEKPWMDFKELQEFKPVDASANA Sbjct: 59 AKKLYEAKVWEKPWMDFKELQEFKPVDASANA 90
>gi|118170|sp|P09229|CYT1_ORYSA CYSTEINE PROTEINASE INHIBITOR-I (ORYZACYSTATIN-I) gi|82491|pir||A28464 oryzacystatin - rice gi|13096692|pdb|1EQK|A Chain A, Solution Structure Of Oryzacystatin-I, A Cysteine Proteinase Inhibitor Of The Rice, Oryza Sativa L. Japonica gi|169784|gb|AAA33903.1| oryzacystatin gi|169807|gb|AAA33912.1| oryzastatin gi|259137|gb|AAB24010.1| oryzacystatin [Oryza] gi|1280613|gb|AAB66355.1| oryzacystatin gi|16904246|gb|AAL30830.1|AF435976_1 cystatin [Oryza sativa] gi|19571011|dbj|BAB86438.1| oryzacystatin [Oryza sativa (japonica cultivar-group)] gi|20804550|dbj|BAB92242.1| oryzacystatin [Oryza sativa (japonica cultivar-group)] Length = 102 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 270 AKKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 AKKLYEAKVWEKPWMDFKELQEFKPVDASANA Sbjct: 71 AKKLYEAKVWEKPWMDFKELQEFKPVDASANA 102
>gi|1076797|pir||S54828 cysteine proteinase inhibitor precursor - maize gi|809608|emb|CAA60610.1| cysteine proteinase inhibitor [Zea mays] Length = 134 Score = 59.7 bits (143), Expect = 9e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KKLYEAKVWEKPW +FKELQEFKPVD A+A Sbjct: 104 KKLYEAKVWEKPWENFKELQEFKPVDEGASA 134
>gi|2118423|pir||JC4882 cystatin - maize gi|1498133|dbj|BAA09666.1| cysteine proteinase inhibitor [Zea mays] Length = 134 Score = 58.2 bits (139), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KKLYEAKVWEKPW +FKELQEFKPV+ A+A Sbjct: 104 KKLYEAKVWEKPWENFKELQEFKPVEEGASA 134
>gi|2130095|pir||PC6025 cysteine proteinase inhibitor - sorghum (fragment) gi|809576|emb|CAA60634.1| cysteine proteinase inhibitor [Sorghum bicolor] Length = 130 Score = 58.2 bits (139), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KKLYEAKVWEKPW +FKELQEFKPV+ A+A Sbjct: 100 KKLYEAKVWEKPWENFKELQEFKPVEEGASA 130
>gi|1008922|dbj|BAA07327.1| cystatin II [Zea mays] Length = 134 Score = 57.4 bits (137), Expect = 4e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KKLYEAKVWEKPW FKELQEFKPV+ A+A Sbjct: 104 KKLYEAKVWEKPWEKFKELQEFKPVEEGASA 134
>gi|1076795|pir||JC4007 cystatin II - maize Length = 135 Score = 57.4 bits (137), Expect = 4e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KKLYEAKVWEKPW FKELQEFKPV+ A+A Sbjct: 105 KKLYEAKVWEKPWEKFKELQEFKPVEEGASA 135
>gi|399334|sp|P31726|CYT1_MAIZE Cystatin I precursor (CORN kernel cysteine proteinase inhibitor) gi|322868|pir||S27239 cysteine proteinase inhibitor - maize gi|217962|dbj|BAA01472.1| corn cystatin I [Zea mays] Length = 135 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KKLYEAKVWEKPW +FK+LQEFKPV+ A+A Sbjct: 105 KKLYEAKVWEKPWENFKQLQEFKPVEEGASA 135
>gi|11559283|dbj|BAB18768.1| cysteine proteinase inhibitor [Triticum aestivum] Length = 125 Score = 57.0 bits (136), Expect = 6e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 270 AKKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 AKKLYEAKVWEKPW +FK+LQEFKPV+ +A A Sbjct: 94 AKKLYEAKVWEKPWENFKQLQEFKPVEDAAIA 125
>gi|12657579|dbj|BAB21558.1| cystatin [Coix lacryma-jobi] Length = 135 Score = 55.5 bits (132), Expect = 2e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KKLYEAKVWEKPW +FKEL EFKPV+ A+A Sbjct: 105 KKLYEAKVWEKPWENFKELLEFKPVEEDASA 135
>gi|11559285|dbj|BAB18769.1| cysteine proteinase inhibitor [Triticum aestivum] Length = 78 Score = 55.1 bits (131), Expect = 2e-07 Identities = 24/33 (72%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = -2 Query: 270 AKKLYEAKVWEKPWMDFKELQEFKPVD-ASANA 175 AKK+YEAKVWE+PWMDFK+L EF+P + ASA+A Sbjct: 46 AKKMYEAKVWERPWMDFKKLMEFRPAERASASA 78
>gi|168556|gb|AAA18557.1| putative. similar to cystatins Length = 52 Score = 55.1 bits (131), Expect = 2e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 264 KLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KLYEAKVWEKPW +FK+LQEFKPV+ A+A Sbjct: 23 KLYEAKVWEKPWENFKQLQEFKPVEEGASA 52
>gi|1706276|sp|Q10992|CYTA_HELAN Cysteine proteinase inhibitor A (Cystatin A) (SCA) gi|2118422|pir||JC4791 cysteine proteinase inhibitor Sca - common sunflower Length = 82 Score = 54.3 bits (129), Expect = 4e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASAN 178 KK YEAKVW KPW +FKELQEFKPVDA+ + Sbjct: 53 KKTYEAKVWVKPWENFKELQEFKPVDAATS 82
>gi|18399630|ref|NP_566425.1| cysteine proteinase inhibitor, putative; protein id: At3g12490.1 [Arabidopsis thaliana] gi|17473693|gb|AAL38303.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana] gi|21554079|gb|AAM63160.1| cysteine proteinase inhibitor, putative [Arabidopsis thaliana] Length = 201 Score = 54.3 bits (129), Expect = 4e-07 Identities = 32/61 (52%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA*GPSRILCVSSYQEDG--E*YGVDIAIGH 94 KKLYEAKVW KPW++FKELQEFKP + A A S + C E G E G D + H Sbjct: 68 KKLYEAKVWVKPWLNFKELQEFKPA-SDAPAITSSDLGCKQGEHESGWREVPGDDPEVKH 126 Query: 93 V 91 V Sbjct: 127 V 127
>gi|12321971|gb|AAG51028.1|AC069474_27 cysteine proteinase inhibitor, putative; 65918-67271 [Arabidopsis thaliana] gi|15795168|dbj|BAB03156.1| cysteine proteinase inhibitor-like protein [Arabidopsis thaliana] Length = 234 Score = 54.3 bits (129), Expect = 4e-07 Identities = 32/61 (52%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA*GPSRILCVSSYQEDG--E*YGVDIAIGH 94 KKLYEAKVW KPW++FKELQEFKP + A A S + C E G E G D + H Sbjct: 101 KKLYEAKVWVKPWLNFKELQEFKPA-SDAPAITSSDLGCKQGEHESGWREVPGDDPEVKH 159 Query: 93 V 91 V Sbjct: 160 V 160
>gi|11358954|pir||JC7333 multicystatin - common sunflower gi|7707812|dbj|BAA95416.1| multicystatin [Helianthus annuus] Length = 282 Score = 53.9 bits (128), Expect = 5e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDAS 184 KK YEAKVW KPW +FKELQEFKPVDA+ Sbjct: 163 KKTYEAKVWVKPWENFKELQEFKPVDAA 190
Score = 47.8 bits (112), Expect = 4e-05 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -2 Query: 264 KLYEAKVWEKPWMDFKELQEFKPVDASANA*G 169 K YEAKVW K W + KELQEFKPVDA+ + G Sbjct: 69 KTYEAKVWVKKWENLKELQEFKPVDAATSVIG 100
>gi|24899735|gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana] Length = 201 Score = 53.1 bits (126), Expect = 8e-07 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA*GPSRILCVSSYQEDG 127 KKLYEAKVW KPW++FKELQEFKP + A A S + C E G Sbjct: 68 KKLYEAKVWVKPWLNFKELQEFKPA-SDAPAITSSDLGCKQGEHESG 113
>gi|100671|pir||S13027 cysteine proteinase inhibitor - rice gi|20277|emb|CAA40860.1| oryzacystatin II [Oryza sativa (japonica cultivar-group)] Length = 106 Score = 52.0 bits (123), Expect = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -2 Query: 270 AKKLYEAKVWEKPWMDFKELQEFKPVDASA 181 A KLYEAKVWE+ W +FK+LQ+FKP+DA+A Sbjct: 77 ANKLYEAKVWERAWENFKQLQDFKPLDATA 106
>gi|18158608|gb|AAL59842.1| cysteine protease inhibitor CPI-1 [Brassica oleracea] Length = 207 Score = 52.0 bits (123), Expect = 2e-06 Identities = 31/66 (46%), Positives = 37/66 (56%), Gaps = 7/66 (10%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVD---ASANA*GPSRILCVSSYQEDG----E*YGVD 109 KKLYEAKVW KPW++FKELQEFKP A + PS + C E+ E G D Sbjct: 68 KKLYEAKVWVKPWLNFKELQEFKPASDDGAPSTTITPSDLGCKKVSDENASGWREVPGDD 127 Query: 108 IAIGHV 91 + HV Sbjct: 128 PEVQHV 133
>gi|7488521|pir||T14386 cysteine proteinase inhibitor BCPI-2 - turnip gi|1256424|gb|AAA96316.1| cysteine proteinase inhibitor Length = 205 Score = 52.0 bits (123), Expect = 2e-06 Identities = 24/33 (72%), Positives = 27/33 (81%), Gaps = 2/33 (6%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPV--DASANA 175 KKLYEAKVW KPW++FKELQEFKP D S +A Sbjct: 67 KKLYEAKVWVKPWLNFKELQEFKPASDDGSPSA 99
>gi|11139270|gb|AAG31653.1| PRLI-interacting factor M [Arabidopsis thaliana] Length = 209 Score = 52.0 bits (123), Expect = 2e-06 Identities = 31/61 (50%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA*GPSRILCVSSYQEDG--E*YGVDIAIGH 94 KKLYEAKVW KPW++FKELQEF P + A A S + C E G E G D + H Sbjct: 76 KKLYEAKVWVKPWLNFKELQEFTPA-SDAPAITSSDLGCKQGEHESGWREVPGDDPEVKH 134 Query: 93 V 91 V Sbjct: 135 V 135
>gi|2129783|pir||S65071 cystatin - field mustard gi|762785|gb|AAC37479.1| cysteine proteinase inhibitor Length = 199 Score = 51.6 bits (122), Expect = 2e-06 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKP 196 KKLYEAKVW KPW++FKELQEFKP Sbjct: 68 KKLYEAKVWVKPWLNFKELQEFKP 91
>gi|7488657|pir||T07139 cysteine proteinase inhibitor - soybean gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 51.6 bits (122), Expect = 2e-06 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKP 196 KKLYEAKVW KPW++FKELQEFKP Sbjct: 112 KKLYEAKVWVKPWLNFKELQEFKP 135
>gi|1169196|sp|Q06445|CYTI_VIGUN CYSTEINE PROTEINASE INHIBITOR (CYSTATIN) gi|481817|pir||S39506 cysteine proteinase inhibitor - cowpea gi|288188|emb|CAA79954.1| cysteine proteinase inhibitor [Vigna unguiculata] Length = 97 Score = 51.6 bits (122), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPV-DASA 181 KK+YEAKVWEKPW++FKELQEFK V DA A Sbjct: 68 KKVYEAKVWEKPWLNFKELQEFKHVGDAPA 97
>gi|8099682|gb|AAF72202.1|AF265551_1 cysteine protease inhibitor [Manihot esculenta] Length = 101 Score = 51.2 bits (121), Expect = 3e-06 Identities = 19/24 (79%), Positives = 24/24 (100%) Frame = -2 Query: 264 KLYEAKVWEKPWMDFKELQEFKPV 193 K+YEAKVWEKPW++FKE+QEFKP+ Sbjct: 69 KVYEAKVWEKPWLNFKEVQEFKPI 92
>gi|13183179|gb|AAK15090.1|AF240007_1 cystatin [Sesamum indicum] Length = 199 Score = 51.2 bits (121), Expect = 3e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPV 193 KKLYEAK+W KPWMDFK+LQEFK V Sbjct: 65 KKLYEAKIWVKPWMDFKQLQEFKHV 89
>gi|18030077|gb|AAL56612.1|AF454396_1 cystatin [Vigna radiata] Length = 88 Score = 50.8 bits (120), Expect = 4e-06 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPV 193 KK+YEAKVWEKPW++FKELQEFK V Sbjct: 59 KKVYEAKVWEKPWLNFKELQEFKLV 83
>gi|6671192|gb|AAF23126.1|AF198388_1 cystatin [Lycopersicon esculentum] Length = 235 Score = 50.4 bits (119), Expect = 5e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVD 190 KKLYEAKVW KPW++FKELQEFK V+ Sbjct: 103 KKLYEAKVWVKPWLNFKELQEFKHVE 128
>gi|25392144|pir||JC7636 cystatin 1 - wheat gi|11559279|dbj|BAB18766.1| cysteine proteinase inhibitor [Triticum aestivum] Length = 142 Score = 50.1 bits (118), Expect = 7e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -2 Query: 270 AKKLYEAKVWEKPWMDFKELQEFKPVD 190 AKKLYEAKVWEKPW +FK+L+EFK V+ Sbjct: 111 AKKLYEAKVWEKPWENFKKLEEFKLVE 137
>gi|9650760|emb|CAA72790.1| cysteine proteinase inhibitor [Hordeum vulgare subsp. vulgare] Length = 107 Score = 50.1 bits (118), Expect = 7e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 270 AKKLYEAKVWEKPWMDFKELQEFKP 196 AKKLYEAKVWEK W +FK+LQEFKP Sbjct: 81 AKKLYEAKVWEKAWENFKQLQEFKP 105
>gi|13603389|gb|AAK30004.1| cysteine proteinase inhibitor [Dianthus caryophyllus] Length = 98 Score = 48.9 bits (115), Expect = 2e-05 Identities = 23/30 (76%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPV-DASA 181 KKLYEAKVW KPW++FKE+Q+FK V DASA Sbjct: 69 KKLYEAKVWVKPWVNFKEVQDFKYVGDASA 98
>gi|4150974|emb|CAA11899.1| cystatin [Castanea sativa] Length = 102 Score = 48.9 bits (115), Expect = 2e-05 Identities = 18/23 (78%), Positives = 23/23 (100%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFK 199 KK+YEAK+WEKPW++FKE+QEFK Sbjct: 69 KKVYEAKIWEKPWLNFKEVQEFK 91
>gi|2317876|gb|AAB71505.1| cysteine protease inhibitor [Pyrus communis] Length = 95 Score = 48.9 bits (115), Expect = 2e-05 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDAS 184 KK+YEAKVW KPW +FK++QEFKPV S Sbjct: 68 KKVYEAKVWVKPWENFKQVQEFKPVSDS 95
>gi|6721552|dbj|BAA89582.1| unnamed protein product [Oryza sativa (japonica cultivar-group)] Length = 250 Score = 48.5 bits (114), Expect = 2e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFK 199 KK+YEAKVW KPW+DFKELQEF+ Sbjct: 112 KKVYEAKVWVKPWLDFKELQEFR 134
>gi|15238418|ref|NP_196130.1| cysteine proteinase inhibitor-like protein; protein id: At5g05110.1, supported by cDNA: 27304., supported by cDNA: gi_13877810, supported by cDNA: gi_16323483 [Arabidopsis thaliana] gi|10178050|dbj|BAB11533.1| cysteine proteinase inhibitor-like protein [Arabidopsis thaliana] gi|13877811|gb|AAK43983.1|AF370168_1 putative cysteine proteinase inhibitor [Arabidopsis thaliana] gi|16323484|gb|AAL15236.1| putative cysteine proteinase inhibitor [Arabidopsis thaliana] Length = 232 Score = 48.5 bits (114), Expect = 2e-05 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPV 193 KK+YEAKVW KPWM+FK+LQEFK + Sbjct: 110 KKIYEAKVWVKPWMNFKQLQEFKNI 134
>gi|118171|sp|P20907|CYT2_ORYSA CYSTEINE PROTEINASE INHIBITOR-II (ORYZACYSTATIN-II) gi|100692|pir||A38375 oryzacystatin II - rice gi|169803|gb|AAA33911.1| oryzacystatin-II Length = 107 Score = 48.5 bits (114), Expect = 2e-05 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -2 Query: 270 AKKLYEAKVWEKPWMDFKELQEFKPVD 190 A KLYEAKVWE+ W +FK+LQ+FKP+D Sbjct: 77 ANKLYEAKVWERAWENFKQLQDFKPLD 103
>gi|21555194|gb|AAM63801.1| cysteine proteinase inhibitor-like protein [Arabidopsis thaliana] Length = 230 Score = 48.5 bits (114), Expect = 2e-05 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPV 193 KK+YEAKVW KPWM+FK+LQEFK + Sbjct: 108 KKIYEAKVWVKPWMNFKQLQEFKNI 132
>gi|1076243|pir||JH0269 cystatin - avocado gi|1586085|prf||2203261A Cys protease inhibitor Length = 100 Score = 48.1 bits (113), Expect = 3e-05 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASAN 178 KK+YEAKVW K W +FKELQEFKPV S++ Sbjct: 66 KKIYEAKVWVKLWENFKELQEFKPVGDSSS 95
>gi|7488895|pir||T10057 cysteine proteinase inhibitor (clone JS41) - castor bean gi|1638842|emb|CAA89697.1| cysteine proteinase inhibitor [Ricinus communis] Length = 209 Score = 48.1 bits (113), Expect = 3e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFK 199 KK+YEAKVW KPW++FKELQEFK Sbjct: 70 KKIYEAKVWVKPWLNFKELQEFK 92
>gi|18874516|gb|AAL79831.1|AF469485_1 cystatin [Sandersonia aurantiaca] Length = 110 Score = 47.8 bits (112), Expect = 4e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFK 199 KKLYEAKVW KPW++FKELQEF+ Sbjct: 69 KKLYEAKVWVKPWLNFKELQEFR 91
>gi|7438238|pir||T07051 cysteine proteinase inhibitor - soybean (fragment) gi|1277164|gb|AAA97905.1| cysteine proteinase inhibitor Length = 92 Score = 47.0 bits (110), Expect = 6e-05 Identities = 22/30 (73%), Positives = 26/30 (86%), Gaps = 1/30 (3%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPV-DASA 181 KK+YEAKVWEK W++FKE+QEFK V DA A Sbjct: 63 KKVYEAKVWEKSWLNFKEVQEFKLVGDAPA 92
>gi|7488656|pir||T07054 cysteine proteinase inhibitor (clone R1) - soybean (fragment) gi|1277168|gb|AAA97907.1| cysteine proteinase inhibitor Length = 100 Score = 46.6 bits (109), Expect = 8e-05 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASAN 178 KK+YE KV EKPW++ KE+QEFKP+ + N Sbjct: 65 KKVYETKVLEKPWLNIKEVQEFKPITVAVN 94
>gi|18307510|emb|CAD21441.1| putative cysteine proteinase inhibitor [Rumex obtusifolius] Length = 99 Score = 46.6 bits (109), Expect = 8e-05 Identities = 18/23 (78%), Positives = 22/23 (95%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFK 199 KK+YEAKVW KPWM+FK++QEFK Sbjct: 68 KKVYEAKVWVKPWMNFKQVQEFK 90
>gi|7595872|gb|AAF64480.1|AF241536_1 cysteine protease inhibitor [Ipomoea batatas] Length = 254 Score = 45.1 bits (105), Expect = 2e-04 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVD 190 +KLYEAKVW KPWM+FKELQ F ++ Sbjct: 121 RKLYEAKVWLKPWMNFKELQGFNHIE 146
>gi|4261517|gb|AAD13812.1| cysteine proteinase inhibitor [Ipomoea batatas] Length = 254 Score = 45.1 bits (105), Expect = 2e-04 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVD 190 +KLYEAKVW KPWM+FKELQ F ++ Sbjct: 121 RKLYEAKVWLKPWMNFKELQGFNHIE 146
>gi|6671194|gb|AAF23127.1|AF198389_1 cystatin [Lycopersicon esculentum] Length = 94 Score = 43.9 bits (102), Expect = 5e-04 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = -2 Query: 267 KKLYEAKVWEKPWMDFKELQEFKPVDASANA 175 KK YEAKVW KPW +FK++++FK + +A A Sbjct: 64 KKAYEAKVWVKPWQNFKQVEDFKLIGDAATA 94
>gi|4929216|gb|AAD33907.1|AF143677_1 cysteine proteinase inhibitor [Artemisia vulgaris] Length = 90 Score = 43.5 bits (101), Expect = 7e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 264 KLYEAKVWEKPWMDFKELQEFKP 196 K YEAK+W KPW +F+ELQEFKP Sbjct: 66 KTYEAKLWVKPWENFQELQEFKP 88
>gi|11127597|dbj|BAB17683.1| cysteine proteinase inhibitor homolog [Arabidopsis thaliana] Length = 92 Score = 42.7 bits (99), Expect = 0.001 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -2 Query: 264 KLYEAKVWEKPWMDFKELQEFK 199 K +EAKVW KPWM+FK+LQEFK Sbjct: 67 KNFEAKVWVKPWMNFKQLQEFK 88
>gi|19347961|gb|AAL86314.1| putative cysteine proteinase inhibitor cystatin B [Arabidopsis thaliana] Length = 116 Score = 42.7 bits (99), Expect = 0.001 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -2 Query: 264 KLYEAKVWEKPWMDFKELQEFK 199 K +EAKVW KPWM+FK+LQEFK Sbjct: 91 KNFEAKVWVKPWMNFKQLQEFK 112
>gi|15226769|ref|NP_181620.1| putative cysteine proteinase inhibitor B (cystatin B); protein id: At2g40880.1, supported by cDNA: 11739. [Arabidopsis thaliana] gi|7438234|pir||T00752 cysteine proteinase inhibitor homolog T20B5.8 - Arabidopsis thaliana gi|2623302|gb|AAB86448.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis thaliana] gi|21536996|gb|AAM61337.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis thaliana] gi|23297693|gb|AAN13009.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis thaliana] Length = 125 Score = 42.7 bits (99), Expect = 0.001 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -2 Query: 264 KLYEAKVWEKPWMDFKELQEFK 199 K +EAKVW KPWM+FK+LQEFK Sbjct: 100 KNFEAKVWVKPWMNFKQLQEFK 121
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 206,513,291 Number of Sequences: 1247039 Number of extensions: 3867823 Number of successful extensions: 8917 Number of sequences better than 10.0: 150 Number of HSP's better than 10.0 without gapping: 8768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8915 length of database: 397,579,747 effective HSP length: 65 effective length of database: 316,522,212 effective search space used: 7596533088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)