Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039725014-019163-13698 Query= (183 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039725014-019163-13698
Query= (183 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|15219327|ref|NP_173115.1| unknown protein; protein id: A... 67 6e-11 gi|25518555|pir||E86302 hypothetical protein F17F16.8 [impo... 67 6e-11 gi|15230656|ref|NP_187904.1| putative CREB-binding protein;... 54 6e-07 gi|21105785|gb|AAM34790.1|AF512560_2 HAC4 [Arabidopsis thal... 50 8e-06 gi|8778322|gb|AAF79331.1|AC002304_24 F14J16.27 [Arabidopsis... 50 8e-06 gi|14794966|gb|AAK73519.1| HAC4 [Arabidopsis thaliana] 50 8e-06 gi|18405622|ref|NP_564706.1| CREB-binding protein, putative... 50 8e-06 gi|18412221|ref|NP_565197.1| expressed protein; protein id:... 40 0.011 gi|7487910|pir||T01055 hypothetical protein YUP8H12R.38 - A... 40 0.011 gi|15240763|ref|NP_201549.1| putative protein; protein id: ... 32 2.3 gi|15021458|gb|AAK77735.1|AF369029_66 ORF66 [shrimp white s... 32 2.9 gi|17158204|ref|NP_477622.1| wsv100 [shrimp white spot synd... 32 2.9 gi|19481748|gb|AAL89024.1| WSSV156 [shrimp white spot syndr... 32 2.9 gi|21537174|gb|AAM61515.1| unknown [Arabidopsis thaliana] 30 6.6 gi|18420081|ref|NP_568031.1| putative protein; protein id: ... 30 6.6 gi|7485765|pir||T04718 hypothetical protein F19F18.100 - Ar... 30 6.6 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|15219327|ref|NP_173115.1| unknown protein; protein id: A... 67 6e-11 gi|25518555|pir||E86302 hypothetical protein F17F16.8 [impo... 67 6e-11 gi|15230656|ref|NP_187904.1| putative CREB-binding protein;... 54 6e-07 gi|21105785|gb|AAM34790.1|AF512560_2 HAC4 [Arabidopsis thal... 50 8e-06 gi|8778322|gb|AAF79331.1|AC002304_24 F14J16.27 [Arabidopsis... 50 8e-06 gi|14794966|gb|AAK73519.1| HAC4 [Arabidopsis thaliana] 50 8e-06 gi|18405622|ref|NP_564706.1| CREB-binding protein, putative... 50 8e-06 gi|18412221|ref|NP_565197.1| expressed protein; protein id:... 40 0.011 gi|7487910|pir||T01055 hypothetical protein YUP8H12R.38 - A... 40 0.011 gi|15240763|ref|NP_201549.1| putative protein; protein id: ... 32 2.3 gi|15021458|gb|AAK77735.1|AF369029_66 ORF66 [shrimp white s... 32 2.9 gi|17158204|ref|NP_477622.1| wsv100 [shrimp white spot synd... 32 2.9 gi|19481748|gb|AAL89024.1| WSSV156 [shrimp white spot syndr... 32 2.9 gi|21537174|gb|AAM61515.1| unknown [Arabidopsis thaliana] 30 6.6 gi|18420081|ref|NP_568031.1| putative protein; protein id: ... 30 6.6 gi|7485765|pir||T04718 hypothetical protein F19F18.100 - Ar... 30 6.6
>gi|15219327|ref|NP_173115.1| unknown protein; protein id: At1g16710.1 [Arabidopsis thaliana] Length = 1706 Score = 67.0 bits (162), Expect = 6e-11 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRDLKEHXXXXXXXXXXXXXAAVNEMMRQRAAEVA 161 +LQLHARAC++S C+VPRC DLKEH AAV EMMRQRAAEVA Sbjct: 1650 LLQLHARACKESECDVPRCGDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEVA 1702
>gi|25518555|pir||E86302 hypothetical protein F17F16.8 [imported] - Arabidopsis thaliana gi|9954734|gb|AAG09087.1|AC026237_8 Unknown Protein [Arabidopsis thaliana] Length = 1498 Score = 67.0 bits (162), Expect = 6e-11 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRDLKEHXXXXXXXXXXXXXAAVNEMMRQRAAEVA 161 +LQLHARAC++S C+VPRC DLKEH AAV EMMRQRAAEVA Sbjct: 1442 LLQLHARACKESECDVPRCGDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEVA 1494
>gi|15230656|ref|NP_187904.1| putative CREB-binding protein; protein id: At3g12980.1 [Arabidopsis thaliana] gi|15795129|dbj|BAB02507.1| CREB-binding protein-like [Arabidopsis thaliana] Length = 1670 Score = 53.9 bits (128), Expect = 6e-07 Identities = 24/55 (43%), Positives = 33/55 (60%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRDLKEHXXXXXXXXXXXXXAAVNEMMRQRAAEVAAN 167 + +LH+R CRD C VP+CR+L+ H AAV EM+RQRAA+ A+ Sbjct: 1613 LFRLHSRNCRDPQCKVPKCRELRAHFSRKQQQADSRRRAAVMEMVRQRAADTTAS 1667
>gi|21105785|gb|AAM34790.1|AF512560_2 HAC4 [Arabidopsis thaliana] Length = 385 Score = 50.1 bits (118), Expect = 8e-06 Identities = 25/51 (49%), Positives = 30/51 (58%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRDLKEHXXXXXXXXXXXXXAAVNEMMRQRAAE 155 +L+LHAR CRDS C VP+C L+ AAV EMMR+RAAE Sbjct: 330 LLKLHARNCRDSKCTVPKCSGLRAISRRKQQQADKRRRAAVMEMMRERAAE 380
>gi|8778322|gb|AAF79331.1|AC002304_24 F14J16.27 [Arabidopsis thaliana] Length = 1550 Score = 50.1 bits (118), Expect = 8e-06 Identities = 25/51 (49%), Positives = 30/51 (58%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRDLKEHXXXXXXXXXXXXXAAVNEMMRQRAAE 155 +L+LHAR CRDS C VP+C L+ AAV EMMR+RAAE Sbjct: 1495 LLKLHARNCRDSKCTVPKCSGLRAISRRKQQQADKRRRAAVMEMMRERAAE 1545
>gi|14794966|gb|AAK73519.1| HAC4 [Arabidopsis thaliana] Length = 413 Score = 50.1 bits (118), Expect = 8e-06 Identities = 25/51 (49%), Positives = 30/51 (58%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRDLKEHXXXXXXXXXXXXXAAVNEMMRQRAAE 155 +L+LHAR CRDS C VP+C L+ AAV EMMR+RAAE Sbjct: 358 LLKLHARNCRDSKCTVPKCSGLRAISRRKQQQADKRRRAAVMEMMRERAAE 408
>gi|18405622|ref|NP_564706.1| CREB-binding protein, putative; protein id: At1g55970.1, supported by cDNA: gi_14794965 [Arabidopsis thaliana] Length = 1456 Score = 50.1 bits (118), Expect = 8e-06 Identities = 25/51 (49%), Positives = 30/51 (58%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRDLKEHXXXXXXXXXXXXXAAVNEMMRQRAAE 155 +L+LHAR CRDS C VP+C L+ AAV EMMR+RAAE Sbjct: 1401 LLKLHARNCRDSKCTVPKCSGLRAISRRKQQQADKRRRAAVMEMMRERAAE 1451
>gi|18412221|ref|NP_565197.1| expressed protein; protein id: At1g79000.1, supported by cDNA: gi_12597460 [Arabidopsis thaliana] gi|12597461|gb|AAG60059.1| p300/CBP acetyltransferase-related protein 2 [Arabidopsis thaliana] Length = 1654 Score = 39.7 bits (91), Expect = 0.011 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCR 62 +LQLHARAC++S C+VPRCR Sbjct: 1635 LLQLHARACKESECHVPRCR 1654
>gi|7487910|pir||T01055 hypothetical protein YUP8H12R.38 - Arabidopsis thaliana gi|3152587|gb|AAC17068.1| Similar to CREB-binding protein homolog gb|U88570 from D. melanogaster and contains similarity to callus-associated protein gb|U01961 from Nicotiana tabacum. EST gb|W43427 comes from this gene. [Arabidopsis thaliana] Length = 1516 Score = 39.7 bits (91), Expect = 0.011 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCR 62 +LQLHARAC++S C+VPRCR Sbjct: 1497 LLQLHARACKESECHVPRCR 1516
>gi|15240763|ref|NP_201549.1| putative protein; protein id: At5g67480.1, supported by cDNA: gi_15529177, supported by cDNA: gi_17386119 [Arabidopsis thaliana] gi|9757869|dbj|BAB08456.1| gene_id:K9I9.4~pir||T04718~strong similarity to unknown protein [Arabidopsis thaliana] gi|15529178|gb|AAK97683.1| AT5g67480/K9I9_4 [Arabidopsis thaliana] gi|17386120|gb|AAL38606.1|AF446873_1 AT5g67480/K9I9_4 [Arabidopsis thaliana] Length = 372 Score = 32.0 bits (71), Expect = 2.3 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +3 Query: 3 MLQLHARACRDSG-CNVPRCRDLKE 74 +L+LH+R C S C VP CR+LKE Sbjct: 310 LLELHSRVCAGSDQCRVPLCRNLKE 334
>gi|15021458|gb|AAK77735.1|AF369029_66 ORF66 [shrimp white spot syndrome virus] Length = 624 Score = 31.6 bits (70), Expect = 2.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRD 65 ML H CRD+ C+VP+CR+ Sbjct: 596 MLAYHYIVCRDASCDVPKCRE 616
>gi|17158204|ref|NP_477622.1| wsv100 [shrimp white spot syndrome virus] gi|17016498|gb|AAL33104.1| wsv100 [shrimp white spot syndrome virus] Length = 624 Score = 31.6 bits (70), Expect = 2.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRD 65 ML H CRD+ C+VP+CR+ Sbjct: 596 MLAYHYIVCRDASCDVPKCRE 616
>gi|19481748|gb|AAL89024.1| WSSV156 [shrimp white spot syndrome virus] Length = 624 Score = 31.6 bits (70), Expect = 2.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 3 MLQLHARACRDSGCNVPRCRD 65 ML H CRD+ C+VP+CR+ Sbjct: 596 MLAYHYIVCRDASCDVPKCRE 616
>gi|21537174|gb|AAM61515.1| unknown [Arabidopsis thaliana] Length = 367 Score = 30.4 bits (67), Expect = 6.6 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +3 Query: 3 MLQLHARACRDS-GCNVPRCRDLKE 74 +L+LH+R C DS C VP C LKE Sbjct: 303 LLELHSRICVDSEQCKVPLCSSLKE 327
>gi|18420081|ref|NP_568031.1| putative protein; protein id: At4g37610.1, supported by cDNA: 122670. [Arabidopsis thaliana] Length = 368 Score = 30.4 bits (67), Expect = 6.6 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +3 Query: 3 MLQLHARACRDS-GCNVPRCRDLKE 74 +L+LH+R C DS C VP C LKE Sbjct: 304 LLELHSRICVDSEQCKVPLCSSLKE 328
>gi|7485765|pir||T04718 hypothetical protein F19F18.100 - Arabidopsis thaliana gi|4468986|emb|CAB38300.1| putative protein [Arabidopsis thaliana] gi|7270743|emb|CAB80426.1| putative protein [Arabidopsis thaliana] Length = 365 Score = 30.4 bits (67), Expect = 6.6 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +3 Query: 3 MLQLHARACRDS-GCNVPRCRDLKE 74 +L+LH+R C DS C VP C LKE Sbjct: 301 LLELHSRICVDSEQCKVPLCSSLKE 325
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 114,027,284 Number of Sequences: 1247039 Number of extensions: 1504687 Number of successful extensions: 4257 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 3819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4254 length of database: 397,579,747 effective HSP length: 36 effective length of database: 352,686,343 effective search space used: 8464472232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)