Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039751283-019184-29860 Query= (148 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039751283-019184-29860
Query= (148 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|15219429|ref|NP_177471.1| putative serine carboxypeptida... 48 4e-05 gi|15227773|ref|NP_179884.1| putative serine carboxypeptida... 46 2e-04 gi|9758992|dbj|BAB09519.1| serine carboxypeptidase [Arabido... 45 4e-04 gi|15227769|ref|NP_179880.1| putative serine carboxypeptida... 44 5e-04 gi|15228300|ref|NP_187656.1| putative glucose acyltransfera... 44 6e-04 gi|24417488|gb|AAN60354.1| unknown [Arabidopsis thaliana] 44 6e-04 gi|15418807|gb|AAK52316.1| sinapoylglucose:choline sinapoyl... 43 0.001 gi|18416044|ref|NP_568215.1| carboxypeptidase - like protei... 43 0.001 gi|17380718|gb|AAL36189.1| putative carboxypeptidase [Arabi... 43 0.001 gi|15227770|ref|NP_179881.1| putative serine carboxypeptida... 42 0.002 gi|15219431|ref|NP_177472.1| putative serine carboxypeptida... 42 0.002 gi|20260326|gb|AAM13061.1| putative serine carboxypeptidase... 42 0.002 gi|15294270|gb|AAK95312.1|AF410326_1 T20K9.19/T20K9.19 [Ara... 42 0.002 gi|18481965|gb|AAL73563.1|AC079632_7 Putative serine carbox... 42 0.003 gi|25289774|pir||D96759 probable serine carboxypeptidase T9... 41 0.004 gi|15219435|ref|NP_177474.1| putative serine carboxypeptida... 41 0.004 gi|21741390|emb|CAD39672.1| OSJNBb0051N19.3 [Oryza sativa (... 41 0.005 gi|25289789|pir||C84619 probable serine carboxypeptidase I ... 41 0.005 gi|18400137|ref|NP_565546.1| putative serine carboxypeptida... 41 0.005 gi|15217581|ref|NP_174619.1| serine carboxypeptidase, putat... 41 0.005 gi|15227765|ref|NP_179876.1| putative serine carboxypeptida... 40 0.007 gi|8777303|dbj|BAA96893.1| serine carboxypeptidase [Arabido... 40 0.009 gi|22327401|ref|NP_198467.2| serine carboxypeptidase; prote... 40 0.009 gi|15219433|ref|NP_177473.1| putative serine carboxypeptida... 40 0.011 gi|20197126|gb|AAM14928.1| putative serine carboxypeptidase... 39 0.019 gi|15230430|ref|NP_187828.1| serine carboxypeptidase, putat... 39 0.019 gi|15795141|dbj|BAB03129.1| serine carboxypeptidase [Arabid... 39 0.019 gi|18400130|ref|NP_565545.1| putative serine carboxypeptida... 38 0.033 gi|15219427|ref|NP_177470.1| putative serine carboxypeptida... 37 0.095 gi|11357219|pir||T49934 carboxypeptidase-like protein - Ara... 34 0.62 gi|15227772|ref|NP_179883.1| putative serine carboxypeptida... 33 0.81 gi|15230438|ref|NP_187831.1| serine carboxypeptidase, putat... 33 1.1 gi|15795144|dbj|BAB03132.1| serine carboxypeptidase [Arabid... 33 1.1 gi|7579025|gb|AAF64227.1|AF248647_1 glucose acyltransferase... 33 1.4 gi|4101703|gb|AAD01263.1| glucose acyltransferase [Solanum ... 32 1.8 gi|4101707|gb|AAD01265.1| glucose acyltransferase [Solanum ... 32 1.8 gi|15795143|dbj|BAB03131.1| serine carboxypeptidase [Arabid... 32 1.8 gi|12322057|gb|AAG51080.1|AC069472_20 serine carboxypeptida... 32 1.8 gi|18481967|gb|AAL73565.1|AC079632_9 Putative acyltransfera... 32 1.8 gi|22331013|ref|NP_566414.2| serine carboxypeptidase, putat... 32 1.8 gi|15239759|ref|NP_200294.1| unknown protein; protein id: A... 32 2.4 gi|15230440|ref|NP_187832.1| serine carboxypeptidase, putat... 32 2.4 gi|15795145|dbj|BAB03133.1| serine carboxypeptidase [Arabid... 32 2.4 gi|4101705|gb|AAD01264.1| glucose acyltransferase [Solanum ... 30 6.8 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|15219429|ref|NP_177471.1| putative serine carboxypeptida... 48 4e-05 gi|15227773|ref|NP_179884.1| putative serine carboxypeptida... 46 2e-04 gi|9758992|dbj|BAB09519.1| serine carboxypeptidase [Arabido... 45 4e-04 gi|15227769|ref|NP_179880.1| putative serine carboxypeptida... 44 5e-04 gi|15228300|ref|NP_187656.1| putative glucose acyltransfera... 44 6e-04 gi|24417488|gb|AAN60354.1| unknown [Arabidopsis thaliana] 44 6e-04 gi|15418807|gb|AAK52316.1| sinapoylglucose:choline sinapoyl... 43 0.001 gi|18416044|ref|NP_568215.1| carboxypeptidase - like protei... 43 0.001 gi|17380718|gb|AAL36189.1| putative carboxypeptidase [Arabi... 43 0.001 gi|15227770|ref|NP_179881.1| putative serine carboxypeptida... 42 0.002 gi|15219431|ref|NP_177472.1| putative serine carboxypeptida... 42 0.002 gi|20260326|gb|AAM13061.1| putative serine carboxypeptidase... 42 0.002 gi|15294270|gb|AAK95312.1|AF410326_1 T20K9.19/T20K9.19 [Ara... 42 0.002 gi|18481965|gb|AAL73563.1|AC079632_7 Putative serine carbox... 42 0.003 gi|25289774|pir||D96759 probable serine carboxypeptidase T9... 41 0.004 gi|15219435|ref|NP_177474.1| putative serine carboxypeptida... 41 0.004 gi|21741390|emb|CAD39672.1| OSJNBb0051N19.3 [Oryza sativa (... 41 0.005 gi|25289789|pir||C84619 probable serine carboxypeptidase I ... 41 0.005 gi|18400137|ref|NP_565546.1| putative serine carboxypeptida... 41 0.005 gi|15217581|ref|NP_174619.1| serine carboxypeptidase, putat... 41 0.005 gi|15227765|ref|NP_179876.1| putative serine carboxypeptida... 40 0.007 gi|8777303|dbj|BAA96893.1| serine carboxypeptidase [Arabido... 40 0.009 gi|22327401|ref|NP_198467.2| serine carboxypeptidase; prote... 40 0.009 gi|15219433|ref|NP_177473.1| putative serine carboxypeptida... 40 0.011 gi|20197126|gb|AAM14928.1| putative serine carboxypeptidase... 39 0.019 gi|15230430|ref|NP_187828.1| serine carboxypeptidase, putat... 39 0.019 gi|15795141|dbj|BAB03129.1| serine carboxypeptidase [Arabid... 39 0.019 gi|18400130|ref|NP_565545.1| putative serine carboxypeptida... 38 0.033 gi|15219427|ref|NP_177470.1| putative serine carboxypeptida... 37 0.095 gi|11357219|pir||T49934 carboxypeptidase-like protein - Ara... 34 0.62 gi|15227772|ref|NP_179883.1| putative serine carboxypeptida... 33 0.81 gi|15230438|ref|NP_187831.1| serine carboxypeptidase, putat... 33 1.1 gi|15795144|dbj|BAB03132.1| serine carboxypeptidase [Arabid... 33 1.1 gi|7579025|gb|AAF64227.1|AF248647_1 glucose acyltransferase... 33 1.4 gi|4101703|gb|AAD01263.1| glucose acyltransferase [Solanum ... 32 1.8 gi|4101707|gb|AAD01265.1| glucose acyltransferase [Solanum ... 32 1.8 gi|15795143|dbj|BAB03131.1| serine carboxypeptidase [Arabid... 32 1.8 gi|12322057|gb|AAG51080.1|AC069472_20 serine carboxypeptida... 32 1.8 gi|18481967|gb|AAL73565.1|AC079632_9 Putative acyltransfera... 32 1.8 gi|22331013|ref|NP_566414.2| serine carboxypeptidase, putat... 32 1.8 gi|15239759|ref|NP_200294.1| unknown protein; protein id: A... 32 2.4 gi|15230440|ref|NP_187832.1| serine carboxypeptidase, putat... 32 2.4 gi|15795145|dbj|BAB03133.1| serine carboxypeptidase [Arabid... 32 2.4 gi|4101705|gb|AAD01264.1| glucose acyltransferase [Solanum ... 30 6.8
>gi|15219429|ref|NP_177471.1| putative serine carboxypeptidase; protein id: At1g73280.1 [Arabidopsis thaliana] gi|25289788|pir||A96759 protein serine carboxypeptidase T18K17.5 [imported] - Arabidopsis thaliana gi|12324329|gb|AAG52138.1|AC010556_20 putative serine carboxypeptidase; 12385-14737 [Arabidopsis thaliana] Length = 441 Score = 47.8 bits (112), Expect = 4e-05 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L+ +WAN R+ L IKK T+ E VRCH G+PY+ DI+SSI Sbjct: 300 YRFLLAAYWANDETVRKALQIKKETIGEWVRCH-YGIPYNYDIKSSI 345
>gi|15227773|ref|NP_179884.1| putative serine carboxypeptidase I; protein id: At2g23010.1 [Arabidopsis thaliana] gi|25289775|pir||E84619 probable serine carboxypeptidase I [imported] - Arabidopsis thaliana gi|3169175|gb|AAC17818.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 437 Score = 45.8 bits (107), Expect = 2e-04 Identities = 22/47 (46%), Positives = 30/47 (63%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 YP +L WAN+ + RE L + KG++ E +R H G+PY DI SSI Sbjct: 296 YPYHLVECWANNESVREALHVDKGSIGEWIRDH-RGIPYKSDIRSSI 341
>gi|9758992|dbj|BAB09519.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 443 Score = 44.7 bits (104), Expect = 4e-04 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 TY +LS FWAN N R LG+KK + RC+ +PY+ +I +++ Sbjct: 299 TYRYFLSAFWANDENVRRALGVKKVPTGKWNRCNSQNIPYTFEIFNAV 346
>gi|15227769|ref|NP_179880.1| putative serine carboxypeptidase II; protein id: At2g22970.1, supported by cDNA: gi_14517521 [Arabidopsis thaliana] gi|25289781|pir||A84619 probable serine carboxypeptidase II [imported] - Arabidopsis thaliana gi|3169171|gb|AAC17814.1| putative serine carboxypeptidase II [Arabidopsis thaliana] gi|14517522|gb|AAK62651.1| T20K9.18/T20K9.18 [Arabidopsis thaliana] gi|20197275|gb|AAM15007.1| putative serine carboxypeptidase II [Arabidopsis thaliana] gi|21360533|gb|AAM47382.1| At2g22970/T20K9.18 [Arabidopsis thaliana] gi|23397211|gb|AAN31888.1| putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 433 Score = 44.3 bits (103), Expect = 5e-04 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 YP YL FWAN + R+ L + K ++ + RC+ PY++DI+SS+ Sbjct: 291 YPFYLISFWANDESVRDALHVNKRSIGKWERCNYLSKPYNKDIKSSV 337
>gi|15228300|ref|NP_187656.1| putative glucose acyltransferase; protein id: At3g10450.1 [Arabidopsis thaliana] gi|8567775|gb|AAF76347.1| glucose acyltransferase, putative [Arabidopsis thaliana] gi|12322774|gb|AAG51371.1|AC011560_3 putative glucose acyltransferase; 97813-95037 [Arabidopsis thaliana] gi|21618017|gb|AAM67067.1| putative glucose acyltransferase [Arabidopsis thaliana] Length = 437 Score = 43.9 bits (102), Expect = 6e-04 Identities = 19/47 (40%), Positives = 31/47 (65%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L+ +WAN N + L + KG++ E VRC+ + +PY+ DI+SS+ Sbjct: 296 YRYLLTTYWANDENVQRALHVNKGSIGEWVRCYFE-IPYNHDIKSSV 341
>gi|24417488|gb|AAN60354.1| unknown [Arabidopsis thaliana] Length = 411 Score = 43.9 bits (102), Expect = 6e-04 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L FWAN+ + RE L + KG++ E V+C+ + Y+ DI+SS+ Sbjct: 288 YRYTLMTFWANNKSVREALQVNKGSIGEWVQCNYKNISYNYDIKSSV 334
>gi|15418807|gb|AAK52316.1| sinapoylglucose:choline sinapoyltransferase [Arabidopsis thaliana] Length = 464 Score = 42.7 bits (99), Expect = 0.001 Identities = 20/48 (41%), Positives = 30/48 (62%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 TY +LS FWAN N R LG+KK V + RC+ +PY+ +I +++ Sbjct: 322 TYRYFLSAFWANDENVRRALGVKK--VGKWNRCNSQNIPYTFEIFNAV 367
>gi|18416044|ref|NP_568215.1| carboxypeptidase - like protein; protein id: At5g09640.1 [Arabidopsis thaliana] Length = 464 Score = 42.7 bits (99), Expect = 0.001 Identities = 20/48 (41%), Positives = 30/48 (62%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 TY +LS FWAN N R LG+KK V + RC+ +PY+ +I +++ Sbjct: 322 TYRYFLSAFWANDENVRRALGVKK--VGKWNRCNSQNIPYTFEIFNAV 367
>gi|17380718|gb|AAL36189.1| putative carboxypeptidase [Arabidopsis thaliana] gi|20259065|gb|AAM14248.1| putative carboxypeptidase [Arabidopsis thaliana] Length = 465 Score = 42.7 bits (99), Expect = 0.001 Identities = 20/48 (41%), Positives = 30/48 (62%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 TY +LS FWAN N R LG+KK V + RC+ +PY+ +I +++ Sbjct: 322 TYRYFLSAFWANDENVRRALGVKK-EVGKWNRCNSQNIPYTFEIFNAV 368
>gi|15227770|ref|NP_179881.1| putative serine carboxypeptidase I; protein id: At2g22980.1 [Arabidopsis thaliana] gi|25289782|pir||B84619 probable serine carboxypeptidase I [imported] - Arabidopsis thaliana gi|3169172|gb|AAC17815.1| putative serine carboxypeptidase I [Arabidopsis thaliana] gi|20197276|gb|AAM15008.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 430 Score = 42.0 bits (97), Expect = 0.002 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L FWAN+ + RE L + KG++ + V+C+ + Y+ DI+SS+ Sbjct: 288 YRYTLITFWANNKSVREALQVNKGSIGKWVQCNYKNISYNYDIKSSV 334
>gi|15219431|ref|NP_177472.1| putative serine carboxypeptidase; protein id: At1g73290.1 [Arabidopsis thaliana] gi|25289778|pir||B96759 protein serine carboxypeptidase T18K17.4 [imported] - Arabidopsis thaliana gi|12324327|gb|AAG52136.1|AC010556_18 putative serine carboxypeptidase; 8937-11310 [Arabidopsis thaliana] Length = 438 Score = 42.0 bits (97), Expect = 0.002 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L+ +W N N R+ L I K ++ E VRC+ G+PY+ DI+SS+ Sbjct: 297 YRYLLTTYWVNDVNVRKALQINKESIGEWVRCY-FGIPYTHDIKSSV 342
>gi|20260326|gb|AAM13061.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 187 Score = 42.0 bits (97), Expect = 0.002 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L FWAN+ + RE L + KG++ + V+C+ + Y+ DI+SS+ Sbjct: 64 YRYTLITFWANNKSVREALQVNKGSIGKWVQCNYKNISYNYDIKSSV 110
>gi|15294270|gb|AAK95312.1|AF410326_1 T20K9.19/T20K9.19 [Arabidopsis thaliana] gi|23308257|gb|AAN18098.1| At2g22980/T20K9.19 [Arabidopsis thaliana] Length = 250 Score = 42.0 bits (97), Expect = 0.002 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L FWAN+ + RE L + KG++ + V+C+ + Y+ DI+SS+ Sbjct: 108 YRYTLITFWANNKSVREALQVNKGSIGKWVQCNYKNISYNYDIKSSV 154
>gi|18481965|gb|AAL73563.1|AC079632_7 Putative serine carboxypeptidase [Oryza sativa] gi|19920203|gb|AAM08635.1|AC108883_8 Putative serine carboxypeptidase [Oryza sativa] Length = 432 Score = 41.6 bits (96), Expect = 0.003 Identities = 21/44 (47%), Positives = 30/44 (68%) Frame = -1 Query: 133 LSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSIK 2 +S WAN++ RE LGI +GTV RC+ D L Y+ DI+SS++ Sbjct: 294 MSRIWANNDTVREALGIHQGTVPSWQRCNYDIL-YTYDIKSSVR 336
>gi|25289774|pir||D96759 probable serine carboxypeptidase T9L24.47 [imported] - Arabidopsis thaliana gi|11120810|gb|AAG30990.1|AC012396_26 serine carboxypeptidase, putative [Arabidopsis thaliana] Length = 415 Score = 41.2 bits (95), Expect = 0.004 Identities = 19/48 (39%), Positives = 30/48 (62%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 +Y L+ +WAN R+ L I K ++ E RC+ G+PY+ DI+SS+ Sbjct: 273 SYRFMLTTYWANDETVRKALQINKESIGEWTRCY-RGIPYNHDIKSSV 319
>gi|15219435|ref|NP_177474.1| putative serine carboxypeptidase; protein id: At1g73310.1 [Arabidopsis thaliana] gi|12324317|gb|AAG52126.1|AC010556_8 putative serine carboxypeptidase; 2530-4892 [Arabidopsis thaliana] Length = 441 Score = 41.2 bits (95), Expect = 0.004 Identities = 19/48 (39%), Positives = 30/48 (62%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 +Y L+ +WAN R+ L I K ++ E RC+ G+PY+ DI+SS+ Sbjct: 299 SYRFMLTTYWANDETVRKALQINKESIGEWTRCY-RGIPYNHDIKSSV 345
>gi|21741390|emb|CAD39672.1| OSJNBb0051N19.3 [Oryza sativa (japonica cultivar-group)] Length = 462 Score = 40.8 bits (94), Expect = 0.005 Identities = 22/44 (50%), Positives = 27/44 (61%) Frame = -1 Query: 133 LSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSIK 2 LS WAN RE+LGI KGTV RC+ D L Y + I SS++ Sbjct: 326 LSKIWANDEAVRESLGIHKGTVTTWERCNHD-LLYKKQIVSSVE 368
>gi|25289789|pir||C84619 probable serine carboxypeptidase I [imported] - Arabidopsis thaliana gi|8699619|gb|AAF78760.1|AF275313_1 sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana] gi|14334758|gb|AAK59557.1| putative serine carboxypeptidase I [Arabidopsis thaliana] gi|15293253|gb|AAK93737.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 433 Score = 40.8 bits (94), Expect = 0.005 Identities = 21/47 (44%), Positives = 29/47 (61%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 YP +L WAN + RE L I+KG+ + RC+ +PY+ DI SSI Sbjct: 292 YPYHLIECWANDESVREALHIEKGSKGKWARCNRT-IPYNHDIVSSI 337
>gi|18400137|ref|NP_565546.1| putative serine carboxypeptidase I; protein id: At2g22990.1 [Arabidopsis thaliana] gi|20197128|gb|AAC17816.2| putative serine carboxypeptidase I [Arabidopsis thaliana] gi|20197274|gb|AAM15006.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 433 Score = 40.8 bits (94), Expect = 0.005 Identities = 21/47 (44%), Positives = 29/47 (61%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 YP +L WAN + RE L I+KG+ + RC+ +PY+ DI SSI Sbjct: 292 YPYHLIECWANDESVREALHIEKGSKGKWARCNRT-IPYNHDIVSSI 337
>gi|15217581|ref|NP_174619.1| serine carboxypeptidase, putative; protein id: At1g33540.1 [Arabidopsis thaliana] gi|25289776|pir||C86459 probable serine carboxypeptidase, 88458-86107 [imported] - Arabidopsis thaliana gi|12322376|gb|AAG51208.1|AC051630_5 serine carboxypeptidase, putative; 88458-86107 [Arabidopsis thaliana] Length = 446 Score = 40.8 bits (94), Expect = 0.005 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L+ WAN + R L + KG++ + +RC+ D LPY +DI+SS+ Sbjct: 322 YRYLLASHWANDEDVRRELHVVKGSIGKWMRCNWD-LPYEKDIKSSV 367
>gi|15227765|ref|NP_179876.1| putative serine carboxypeptidase I; protein id: At2g22920.1 [Arabidopsis thaliana] gi|25289780|pir||E84618 probable serine carboxypeptidase I [imported] - Arabidopsis thaliana gi|3445209|gb|AAC32439.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 435 Score = 40.4 bits (93), Expect = 0.007 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRC-HDDGLPYSQDIESSI 5 YP YL +W N + R+ L + K ++ + RC + + +PY++DI +SI Sbjct: 292 YPYYLLGYWINDESVRDALHVNKSSIGKWERCTYQNRIPYNKDINNSI 339
>gi|8777303|dbj|BAA96893.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 512 Score = 40.0 bits (92), Expect = 0.009 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L+ +WAN RE L I K ++ E VRC+ +PY+ DI+SS+ Sbjct: 300 YRYLLTTYWANDATVREALQINKESIGEWVRCY-YSIPYNNDIKSSM 345
>gi|22327401|ref|NP_198467.2| serine carboxypeptidase; protein id: At5g36180.1, supported by cDNA: gi_20260289 [Arabidopsis thaliana] gi|20260290|gb|AAM13043.1| serine carboxypeptidase [Arabidopsis thaliana] gi|22136494|gb|AAM91325.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 441 Score = 40.0 bits (92), Expect = 0.009 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L+ +WAN RE L I K ++ E VRC+ +PY+ DI+SS+ Sbjct: 300 YRYLLTTYWANDATVREALQINKESIGEWVRCY-YSIPYNNDIKSSM 345
>gi|15219433|ref|NP_177473.1| putative serine carboxypeptidase; protein id: At1g73300.1 [Arabidopsis thaliana] gi|25289779|pir||C96759 protein serine carboxypeptidase T18K17.3 [imported] - Arabidopsis thaliana gi|12324326|gb|AAG52135.1|AC010556_17 putative serine carboxypeptidase; 5659-8034 [Arabidopsis thaliana] Length = 441 Score = 39.7 bits (91), Expect = 0.011 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y L+ +WAN RE L I K ++ E VRC+ +PY DI+SS+ Sbjct: 300 YRYLLTTYWANDATVREALQINKESIGEWVRCYRT-IPYDNDIKSSM 345
>gi|20197126|gb|AAM14928.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 187 Score = 38.9 bits (89), Expect = 0.019 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = -1 Query: 133 LSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 L+ +WAN RE L I+KG++ + +RC+ + + Y DI SSI Sbjct: 50 LAKYWANDERVREALQIRKGSIGKWIRCNSN-IHYDDDIISSI 91
>gi|15230430|ref|NP_187828.1| serine carboxypeptidase, putative; protein id: At3g12203.1 [Arabidopsis thaliana] gi|12322038|gb|AAG51061.1|AC069472_1 serine carboxypeptidase, putative; 18637-16038 [Arabidopsis thaliana] Length = 437 Score = 38.9 bits (89), Expect = 0.019 Identities = 17/43 (39%), Positives = 30/43 (69%) Frame = -1 Query: 133 LSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 LS +WAN + R+ L + +GTV + +RC+ + + Y++DI SS+ Sbjct: 300 LSEYWANEKSVRKALLVNEGTVRKWIRCNTE-IAYNKDIRSSV 341
>gi|15795141|dbj|BAB03129.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 405 Score = 38.9 bits (89), Expect = 0.019 Identities = 17/43 (39%), Positives = 30/43 (69%) Frame = -1 Query: 133 LSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 LS +WAN + R+ L + +GTV + +RC+ + + Y++DI SS+ Sbjct: 268 LSEYWANEKSVRKALLVNEGTVRKWIRCNTE-IAYNKDIRSSV 309
>gi|18400130|ref|NP_565545.1| putative serine carboxypeptidase I; protein id: At2g22960.1 [Arabidopsis thaliana] gi|20197271|gb|AAM15004.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 184 Score = 38.1 bits (87), Expect = 0.033 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = -1 Query: 133 LSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 ++ +WAN RE L I+KG++ + +RC+ + + Y DI SSI Sbjct: 47 IAKYWANDERVREALQIRKGSIGKWIRCNSN-IHYDDDIISSI 88
>gi|15219427|ref|NP_177470.1| putative serine carboxypeptidase; protein id: At1g73270.1 [Arabidopsis thaliana] gi|25289777|pir||H96758 protein serine carboxypeptidase T18K17.6 [imported] - Arabidopsis thaliana gi|12324330|gb|AAG52139.1|AC010556_21 putative serine carboxypeptidase; 15190-18301 [Arabidopsis thaliana] Length = 441 Score = 36.6 bits (83), Expect = 0.095 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y LS++W N R+ L I K ++ E RC D PY++DI SS+ Sbjct: 300 YRYSLSHYWVNDETVRKALQINKESIREWKRC-DWSKPYTKDIISSV 345
>gi|11357219|pir||T49934 carboxypeptidase-like protein - Arabidopsis thaliana gi|7671425|emb|CAB89366.1| carboxypeptidase-like protein [Arabidopsis thaliana] Length = 399 Score = 33.9 bits (76), Expect = 0.62 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKK 77 TY +LS FWAN N R LG+KK Sbjct: 270 TYRYFLSAFWANDENVRRALGVKK 293
>gi|15227772|ref|NP_179883.1| putative serine carboxypeptidase I; protein id: At2g23000.1, supported by cDNA: 33165. [Arabidopsis thaliana] gi|25289783|pir||D84619 probable serine carboxypeptidase I [imported] - Arabidopsis thaliana gi|3169174|gb|AAC17817.1| putative serine carboxypeptidase I [Arabidopsis thaliana] Length = 437 Score = 33.5 bits (75), Expect = 0.81 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = -1 Query: 145 YPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 Y +L WAN+ RE L + KGT + RC+ +PY +I SS+ Sbjct: 296 YLYFLIECWANNERVREALHVTKGTKGQWQRCNWT-IPYDNNIISSV 341
>gi|15230438|ref|NP_187831.1| serine carboxypeptidase, putative; protein id: At3g12230.1 [Arabidopsis thaliana] gi|12322055|gb|AAG51078.1|AC069472_18 serine carboxypeptidase, putative; 26560-24112 [Arabidopsis thaliana] Length = 435 Score = 33.1 bits (74), Expect = 1.1 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 TY LS +WAN+ R L + +G+ + RC D + +QDI+SSI Sbjct: 293 TYRYLLSIYWANNEIVRRALKVVEGSKGKWERC-DLSVRSNQDIKSSI 339
>gi|15795144|dbj|BAB03132.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 441 Score = 33.1 bits (74), Expect = 1.1 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 TY LS +WAN+ R L + +G+ + RC D + +QDI+SSI Sbjct: 293 TYRYLLSIYWANNEIVRRALKVVEGSKGKWERC-DLSVRSNQDIKSSI 339
>gi|7579025|gb|AAF64227.1|AF248647_1 glucose acyltransferase [Lycopersicon pennellii] Length = 464 Score = 32.7 bits (73), Expect = 1.4 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 139 NYL-SYFWANSNNTRENLGIKKGTVDEGVRCHD 44 NY+ SY WAN ++ L +++GT E VRC++ Sbjct: 311 NYIYSYVWANDKAVQKALNVREGTTLEWVRCNE 343
>gi|4101703|gb|AAD01263.1| glucose acyltransferase [Solanum berthaultii] Length = 464 Score = 32.3 bits (72), Expect = 1.8 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 139 NYL-SYFWANSNNTRENLGIKKGTVDEGVRCHD 44 NY+ SY WAN ++ L +++GT E VRC++ Sbjct: 311 NYIYSYVWANDKVVQKALNVREGTTLEWVRCNE 343
>gi|4101707|gb|AAD01265.1| glucose acyltransferase [Solanum berthaultii] Length = 461 Score = 32.3 bits (72), Expect = 1.8 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 139 NYL-SYFWANSNNTRENLGIKKGTVDEGVRCHD 44 NY+ SY WAN ++ L +++GT E VRC++ Sbjct: 308 NYIYSYVWANDKVVQKALNVREGTTLEWVRCNE 340
>gi|15795143|dbj|BAB03131.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 440 Score = 32.3 bits (72), Expect = 1.8 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 +Y + LS +WAN+ + R L + +GT RC L ++DI+SSI Sbjct: 289 SYRSMLSDYWANNESVRRALKVVEGTTGRWERCKWT-LQNNKDIKSSI 335
>gi|12322057|gb|AAG51080.1|AC069472_20 serine carboxypeptidase, putative; 23596-21212 [Arabidopsis thaliana] Length = 435 Score = 32.3 bits (72), Expect = 1.8 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 +Y + LS +WAN+ + R L + +GT RC L ++DI+SSI Sbjct: 293 SYRSMLSDYWANNESVRRALKVVEGTTGRWERCKWT-LQNNKDIKSSI 339
>gi|18481967|gb|AAL73565.1|AC079632_9 Putative acyltransferase [Oryza sativa] gi|19920201|gb|AAM08633.1|AC108883_6 Putative serine carboxypeptidase [Oryza sativa] Length = 394 Score = 32.3 bits (72), Expect = 1.8 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -1 Query: 133 LSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLP-YSQDIESSI 5 LSY WA+ R LGI +G++ RC LP + D++S+I Sbjct: 255 LSYLWADDPEVRATLGIHEGSIASWSRC--TALPLFRHDVDSAI 296
>gi|22331013|ref|NP_566414.2| serine carboxypeptidase, putative; protein id: At3g12220.1 [Arabidopsis thaliana] Length = 432 Score = 32.3 bits (72), Expect = 1.8 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 +Y + LS +WAN+ + R L + +GT RC L ++DI+SSI Sbjct: 290 SYRSMLSDYWANNESVRRALKVVEGTTGRWERCKWT-LQNNKDIKSSI 336
>gi|15239759|ref|NP_200294.1| unknown protein; protein id: At5g54830.1, supported by cDNA: gi_19699058 [Arabidopsis thaliana] gi|9758263|dbj|BAB08762.1| gene_id:MBG8.9~unknown protein [Arabidopsis thaliana] gi|19699059|gb|AAL90897.1| AT5g54830/MBG8_9 [Arabidopsis thaliana] Length = 907 Score = 32.0 bits (71), Expect = 2.4 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = -1 Query: 139 NYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDI---ESSI 5 NY+++ WA N+T NL + V G+R +DG P++ D ESS+ Sbjct: 211 NYMAFGWAKPNST-SNLMLNADVVVTGIR--EDGFPFADDFYITESSV 255
>gi|15230440|ref|NP_187832.1| serine carboxypeptidase, putative; protein id: At3g12240.1 [Arabidopsis thaliana] gi|12322053|gb|AAG51076.1|AC069472_16 serine carboxypeptidase, putative; 29599-27172 [Arabidopsis thaliana] Length = 449 Score = 32.0 bits (71), Expect = 2.4 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 TY LS +WA++ R L + KG+ RC D + +QDI+SSI Sbjct: 294 TYRYLLSEYWADNETVRRALKVVKGSKGTWERC-DYRVLSNQDIKSSI 340
>gi|15795145|dbj|BAB03133.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 436 Score = 32.0 bits (71), Expect = 2.4 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = -1 Query: 148 TYPNYLSYFWANSNNTRENLGIKKGTVDEGVRCHDDGLPYSQDIESSI 5 TY LS +WA++ R L + KG+ RC D + +QDI+SSI Sbjct: 294 TYRYLLSEYWADNETVRRALKVVKGSKGTWERC-DYRVLSNQDIKSSI 340
>gi|4101705|gb|AAD01264.1| glucose acyltransferase [Solanum berthaultii] Length = 456 Score = 30.4 bits (67), Expect = 6.8 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 139 NYL-SYFWANSNNTRENLGIKKGTVDEGVRCHD 44 NY+ S WAN ++ L +++GT+ E VRC++ Sbjct: 300 NYIYSKIWANDKAVQKALNVREGTILEWVRCNN 332
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 121,861,041 Number of Sequences: 1247039 Number of extensions: 1816291 Number of successful extensions: 6143 Number of sequences better than 10.0: 88 Number of HSP's better than 10.0 without gapping: 6082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6135 length of database: 397,579,747 effective HSP length: 24 effective length of database: 367,650,811 effective search space used: 8823619464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)