Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039752506-029484-5568 Query= (555 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039752506-029484-5568
Query= (555 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|16752157|ref|NP_445524.1| hypothetical protein [Chlamydo... 102 4e-21 gi|11282893|pir||F81737 hypothetical protein TC0129 [import... 100 1e-20 gi|19920142|gb|AAM08574.1|AC092750_8 Hypothetical protein [... 72 3e-12 gi|11282814|pir||G81737 hypothetical protein TC0130 [import... 63 2e-09 gi|15834739|ref|NP_296498.1| hypothetical protein [Chlamydi... 59 3e-08 gi|22296323|dbj|BAC10094.1| alcohol dehydrogenase-like prot... 54 9e-07 gi|22296322|dbj|BAC10093.1| alcohol dehydrogenase-like prot... 47 1e-04 gi|7484267|pir||S59084 hypothetical protein 29.1 - red alga... 45 4e-04 gi|13359451|dbj|BAB33421.1| putative senescence-associated ... 38 0.085 gi|22296324|dbj|BAC10095.1| short chain alcohol dehydrogena... 37 0.11 gi|22296325|dbj|BAC10096.1| short chain alcohol dehydrogena... 36 0.32 gi|21618306|gb|AAM67356.1| unknown [Arabidopsis thaliana] 35 0.72 gi|25283123|pir||H85039 probable alcohol dehydrogenase [imp... 35 0.72 gi|18412155|ref|NP_567251.1| putative alcohol dehydrogenase... 35 0.72 gi|22296331|dbj|BAC10102.1| alcohol dehydrogenase-like prot... 33 2.7 gi|15921442|ref|NP_377111.1| 104aa long hypothetical protei... 33 2.7 gi|15921441|ref|NP_377110.1| 62aa long conserved hypothetic... 33 2.7 gi|17544995|ref|NP_518397.1| PROBABLE ACETYL-COA ACETYLTRAN... 32 3.6 gi|22296320|dbj|BAC10091.1| similar to alcohol dehydrogenas... 32 4.7 gi|22296321|dbj|BAC10092.1| alcohol dehydrogenase-like prot... 32 4.7 gi|21241463|ref|NP_641045.1| conserved hypothetical protein... 32 6.1 gi|22296335|dbj|BAC10106.1| alcohol dehydrogenase-like prot... 32 6.1 gi|23602121|ref|XP_147832.2| similar to hypothetical protei... 32 6.1 gi|19773874|gb|AAL98918.1| IkBL [Rattus norvegicus] 32 6.1 gi|22296332|dbj|BAC10103.1| alcohol dehydrogenase-like prot... 31 8.0 gi|22985250|gb|ZP_00030374.1| hypothetical protein [Burkhol... 31 8.0 gi|15230558|ref|NP_190736.1| short-chain alcohol dehydrogen... 31 8.0 gi|18138077|emb|CAD20601.2| putative ES protein [Ostertagia... 31 8.0 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|16752157|ref|NP_445524.1| hypothetical protein [Chlamydo... 102 4e-21 gi|11282893|pir||F81737 hypothetical protein TC0129 [import... 100 1e-20 gi|19920142|gb|AAM08574.1|AC092750_8 Hypothetical protein [... 72 3e-12 gi|11282814|pir||G81737 hypothetical protein TC0130 [import... 63 2e-09 gi|15834739|ref|NP_296498.1| hypothetical protein [Chlamydi... 59 3e-08 gi|22296323|dbj|BAC10094.1| alcohol dehydrogenase-like prot... 54 9e-07 gi|22296322|dbj|BAC10093.1| alcohol dehydrogenase-like prot... 47 1e-04 gi|7484267|pir||S59084 hypothetical protein 29.1 - red alga... 45 4e-04 gi|13359451|dbj|BAB33421.1| putative senescence-associated ... 38 0.085 gi|22296324|dbj|BAC10095.1| short chain alcohol dehydrogena... 37 0.11 gi|22296325|dbj|BAC10096.1| short chain alcohol dehydrogena... 36 0.32 gi|21618306|gb|AAM67356.1| unknown [Arabidopsis thaliana] 35 0.72 gi|25283123|pir||H85039 probable alcohol dehydrogenase [imp... 35 0.72 gi|18412155|ref|NP_567251.1| putative alcohol dehydrogenase... 35 0.72 gi|22296331|dbj|BAC10102.1| alcohol dehydrogenase-like prot... 33 2.7 gi|15921442|ref|NP_377111.1| 104aa long hypothetical protei... 33 2.7 gi|15921441|ref|NP_377110.1| 62aa long conserved hypothetic... 33 2.7 gi|17544995|ref|NP_518397.1| PROBABLE ACETYL-COA ACETYLTRAN... 32 3.6 gi|22296320|dbj|BAC10091.1| similar to alcohol dehydrogenas... 32 4.7 gi|22296321|dbj|BAC10092.1| alcohol dehydrogenase-like prot... 32 4.7 gi|21241463|ref|NP_641045.1| conserved hypothetical protein... 32 6.1 gi|22296335|dbj|BAC10106.1| alcohol dehydrogenase-like prot... 32 6.1 gi|23602121|ref|XP_147832.2| similar to hypothetical protei... 32 6.1 gi|19773874|gb|AAL98918.1| IkBL [Rattus norvegicus] 32 6.1 gi|22296332|dbj|BAC10103.1| alcohol dehydrogenase-like prot... 31 8.0 gi|22985250|gb|ZP_00030374.1| hypothetical protein [Burkhol... 31 8.0 gi|15230558|ref|NP_190736.1| short-chain alcohol dehydrogen... 31 8.0 gi|18138077|emb|CAD20601.2| putative ES protein [Ostertagia... 31 8.0
>gi|16752157|ref|NP_445524.1| hypothetical protein [Chlamydophila pneumoniae AR39] gi|11282894|pir||F81516 hypothetical protein CP0987 [imported] - Chlamydophila pneumoniae (strain AR39) Length = 216 Score = 102 bits (253), Expect = 4e-21 Identities = 53/93 (56%), Positives = 63/93 (67%) Frame = +2 Query: 74 VPNLPVDVDSWGRSACYP*SNFYPLSDGPSTRHRRITKADFRLCSTGESCSQAPFCLCTR 253 +PN VD++SW RSACYP S FYPLSDG ST HRRITK DFRLCST +SCSQ L Sbjct: 1 MPNRHVDMNSWWRSACYPRSTFYPLSDGDSTFHRRITKPDFRLCSTCKSCSQPILYLYAL 60 Query: 254 GPMSVWPEETFARLRYLLGGLRPIETVYLRLSL 352 ++ E +F LRY LGG RP +T L +S+ Sbjct: 61 LVIANHDEISFGLLRYFLGGYRPSKTARLAMSI 93
>gi|11282893|pir||F81737 hypothetical protein TC0129 [imported] - Chlamydia muridarum (strain Nigg) Length = 216 Score = 100 bits (249), Expect = 1e-20 Identities = 53/93 (56%), Positives = 62/93 (66%) Frame = +2 Query: 74 VPNLPVDVDSWGRSACYP*SNFYPLSDGPSTRHRRITKADFRLCSTGESCSQAPFCLCTR 253 +PN VD++SW RSACYP S FYPLSDG ST HRRITK DFRLCST SCSQ L Sbjct: 1 MPNRHVDMNSWWRSACYPRSTFYPLSDGDSTFHRRITKPDFRLCSTCWSCSQPILYLYAL 60 Query: 254 GPMSVWPEETFARLRYLLGGLRPIETVYLRLSL 352 ++ E +F LRY LGG RP +T L +S+ Sbjct: 61 LVIANHDEISFGLLRYFLGGYRPSKTARLAMSI 93
>gi|19920142|gb|AAM08574.1|AC092750_8 Hypothetical protein [Oryza sativa (japonica cultivar-group)] gi|20087087|gb|AAM10760.1|AC112514_13 Hypothetical protein [Oryza sativa] Length = 285 Score = 72.4 bits (176), Expect = 3e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 263 SVWPEETFARLRYLLGGLRPIETVYLRLSLGPRV 364 SVWPEETFARLRYLLGGLRPIETVYLRLSLGPRV Sbjct: 173 SVWPEETFARLRYLLGGLRPIETVYLRLSLGPRV 206
>gi|11282814|pir||G81737 hypothetical protein TC0130 [imported] - Chlamydia muridarum (strain Nigg) Length = 122 Score = 62.8 bits (151), Expect = 2e-09 Identities = 32/61 (52%), Positives = 35/61 (57%) Frame = +1 Query: 1 TALMGEQPNPWNHLQLQVAKSRHRGAKPSRRCGXXXXXXXXXXXXXXXVERRPFHSAPSD 180 TAL+GEQPNPW+ LQ Q A SRHRGAKP RR V+RR FH P D Sbjct: 62 TALIGEQPNPWDLLQPQDAMSRHRGAKPPRRYELLVAISLLSPEYLLSVKRRRFHFPPPD 121 Query: 181 H 183 H Sbjct: 122 H 122
>gi|15834739|ref|NP_296498.1| hypothetical protein [Chlamydia muridarum] gi|11282815|pir||F81738 hypothetical protein TC0114 [imported] - Chlamydia muridarum (strain Nigg) gi|7190150|gb|AAF38993.1| hypothetical protein [Chlamydia muridarum] Length = 122 Score = 59.3 bits (142), Expect = 3e-08 Identities = 31/61 (50%), Positives = 34/61 (55%) Frame = +1 Query: 1 TALMGEQPNPWNHLQLQVAKSRHRGAKPSRRCGXXXXXXXXXXXXXXXVERRPFHSAPSD 180 TAL+GEQPNPW+ LQ Q A SRHRGAKP RR V+RR FH D Sbjct: 62 TALIGEQPNPWDLLQPQDAMSRHRGAKPPRRYELLVAISLLSPEYLLSVKRRRFHFPRPD 121 Query: 181 H 183 H Sbjct: 122 H 122
>gi|22296323|dbj|BAC10094.1| alcohol dehydrogenase-like protein~contains ESTs D41510(S4048),AU033144(S4048) [Oryza sativa (japonica cultivar-group)] gi|24414200|dbj|BAC22442.1| alcohol dehydrogenase-like protein~contains ESTs D41510(S4048),AU033144(S4048) [Oryza sativa (japonica cultivar-group)] Length = 302 Score = 54.3 bits (129), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHKGDDNRMN 485 VNGHNLVVDGGFTTHKGDDNRMN Sbjct: 280 VNGHNLVVDGGFTTHKGDDNRMN 302
>gi|22296322|dbj|BAC10093.1| alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] gi|24414199|dbj|BAC22441.1| alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] Length = 321 Score = 47.0 bits (110), Expect = 1e-04 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHKGDDNRMN 485 VNGHNLVVDGGFT+HKG D R+N Sbjct: 299 VNGHNLVVDGGFTSHKGSDTRLN 321
>gi|7484267|pir||S59084 hypothetical protein 29.1 - red alga (Chondrus crispus) mitochondrion gi|1334480|emb|CAA87600.1| unique orf [Chondrus crispus] Length = 79 Score = 45.4 bits (106), Expect = 4e-04 Identities = 26/54 (48%), Positives = 32/54 (59%) Frame = -3 Query: 229 LTARLTRRAETKVGLSDPTVPSGRAVAQRIKVTLGITG*SSPRVHIDGKVWHLD 68 LT RL + T+V +DP G + Q+IK TLGIT S RV ID VW+LD Sbjct: 8 LTIRLINQIGTQVSHNDPIFKCGINIVQQIKGTLGITDSSWLRVRIDVTVWYLD 61
>gi|13359451|dbj|BAB33421.1| putative senescence-associated protein [Pisum sativum] Length = 282 Score = 37.7 bits (86), Expect = 0.085 Identities = 23/60 (38%), Positives = 31/60 (51%) Frame = +2 Query: 2 PH*WANSPTLGTTYSSRWRRADIEVPNLPVDVDSWGRSACYP*SNFYPLSDGPSTRHRRI 181 P+ W N+PTLG + RADIE V +++W A YP NF SD S + R + Sbjct: 75 PYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNAWLPQASYPCGNF---SDTSSFKFRSL 131
>gi|22296324|dbj|BAC10095.1| short chain alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] gi|24414201|dbj|BAC22443.1| short chain alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] Length = 287 Score = 37.4 bits (85), Expect = 0.11 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHKGDD 497 V GHNLVVDGG+T HKG D Sbjct: 264 VTGHNLVVDGGYTVHKGAD 282
>gi|22296325|dbj|BAC10096.1| short chain alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] gi|24414202|dbj|BAC22444.1| short chain alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] Length = 429 Score = 35.8 bits (81), Expect = 0.32 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHKG 503 VNGHNLVVD G+T HKG Sbjct: 412 VNGHNLVVDAGYTVHKG 428
>gi|21618306|gb|AAM67356.1| unknown [Arabidopsis thaliana] Length = 167 Score = 34.7 bits (78), Expect = 0.72 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHK 506 VNGHNLVVDGGFTT K Sbjct: 141 VNGHNLVVDGGFTTVK 156
>gi|25283123|pir||H85039 probable alcohol dehydrogenase [imported] - Arabidopsis thaliana gi|4262142|gb|AAD14442.1| putative alcohol dehydrogenase [Arabidopsis thaliana] gi|7270184|emb|CAB77799.1| putative alcohol dehydrogenase [Arabidopsis thaliana] Length = 283 Score = 34.7 bits (78), Expect = 0.72 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHK 506 VNGHNLVVDGGFTT K Sbjct: 257 VNGHNLVVDGGFTTVK 272
>gi|18412155|ref|NP_567251.1| putative alcohol dehydrogenase; protein id: At4g03140.1 [Arabidopsis thaliana] Length = 279 Score = 34.7 bits (78), Expect = 0.72 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHK 506 VNGHNLVVDGGFTT K Sbjct: 253 VNGHNLVVDGGFTTVK 268
>gi|22296331|dbj|BAC10102.1| alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] gi|24414208|dbj|BAC22450.1| alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] Length = 288 Score = 32.7 bits (73), Expect = 2.7 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHK 506 +NGHNLVVDGGFT K Sbjct: 266 INGHNLVVDGGFTVGK 281
>gi|15921442|ref|NP_377111.1| 104aa long hypothetical protein [Sulfolobus tokodaii] gi|15622228|dbj|BAB66220.1| 104aa long hypothetical protein [Sulfolobus tokodaii] Length = 104 Score = 32.7 bits (73), Expect = 2.7 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +2 Query: 59 RADIEVPNLPVDVDSWGRSACYP*SNF 139 RADI+V N VDV S R CYP NF Sbjct: 3 RADIDVANRGVDVSSRPRRPCYPRGNF 29
>gi|15921441|ref|NP_377110.1| 62aa long conserved hypothetical protein [Sulfolobus tokodaii] gi|15622227|dbj|BAB66219.1| 62aa long conserved hypothetical protein [Sulfolobus tokodaii] Length = 62 Score = 32.7 bits (73), Expect = 2.7 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = -3 Query: 139 KVTLGITG*SSPRVHIDGKVWHLDXXXXXXXXXXXXXGWAVRPLM 5 KVT GITG S R HID V ++D G A RPLM Sbjct: 12 KVTPGITGSSRARAHIDPAVCYIDVGSSHPGGAAAPKGRAARPLM 56
>gi|17544995|ref|NP_518397.1| PROBABLE ACETYL-COA ACETYLTRANSFERASE (ACETOACETYL-COA THIOLASE) PROTEIN [Ralstonia solanacearum] gi|17427285|emb|CAD13804.1| PROBABLE ACETYL-COA ACETYLTRANSFERASE (ACETOACETYL-COA THIOLASE) PROTEIN [Ralstonia solanacearum] Length = 393 Score = 32.3 bits (72), Expect = 3.6 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -2 Query: 401 PGQVELGF*PCVRPAGQGTVSGRQFLWGVGLPKGNG 294 P Q+E CV PAGQG RQ G GLP G Sbjct: 46 PEQIEEVIMGCVLPAGQGQAPARQAALGAGLPLSVG 81
>gi|22296320|dbj|BAC10091.1| similar to alcohol dehydrogenase [Oryza sativa (japonica cultivar-group)] gi|24414197|dbj|BAC22439.1| similar to alcohol dehydrogenase [Oryza sativa (japonica cultivar-group)] Length = 309 Score = 32.0 bits (71), Expect = 4.7 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHK 506 VNGHNLVVDGG+T K Sbjct: 285 VNGHNLVVDGGYTVGK 300
>gi|22296321|dbj|BAC10092.1| alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] gi|24414198|dbj|BAC22440.1| alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] Length = 296 Score = 32.0 bits (71), Expect = 4.7 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHK 506 VNGHNLVVDGG+T K Sbjct: 271 VNGHNLVVDGGYTVGK 286
>gi|21241463|ref|NP_641045.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] gi|21106804|gb|AAM35581.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 506 Score = 31.6 bits (70), Expect = 6.1 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 292 PPLPFGRPTPHRNCLPETVPWPAGLTQG*NPSSTCPGGRSNL 417 PP P PTP P P P+G P++ CP G SN+ Sbjct: 55 PPAPAPTPTPAPTPAPTPAPAPSG------PAADCPSGFSNV 90
>gi|22296335|dbj|BAC10106.1| alcohol dehydrogenase-like protein~contains EST C72060(E0889) [Oryza sativa (japonica cultivar-group)] Length = 462 Score = 31.6 bits (70), Expect = 6.1 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHKGDD 497 + GHNLVVDGGFT K D Sbjct: 282 ITGHNLVVDGGFTVGKEKD 300
>gi|23602121|ref|XP_147832.2| similar to hypothetical protein MGC23138 [Homo sapiens] [Mus musculus] Length = 189 Score = 31.6 bits (70), Expect = 6.1 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +1 Query: 292 PPLPFGRPTPHRNCLPETVPWPAGLTQG*NPSSTCPGGRSNLPL 423 PP PF P P +C P VP+PA G P T P N+P+ Sbjct: 85 PPGPF--PPPGPSCPPPGVPYPAPAVPG--PGPTGPYATPNMPM 124
>gi|19773874|gb|AAL98918.1| IkBL [Rattus norvegicus] Length = 106 Score = 31.6 bits (70), Expect = 6.1 Identities = 19/65 (29%), Positives = 28/65 (43%) Frame = +1 Query: 211 G*VLQSSSLLPLHSRTNVRLARGNLCTPPLPFGRPTPHRNCLPETVPWPAGLTQG*NPSS 390 G ++++ +LL H +V + L T P+P P P C P P G G + Sbjct: 41 GRLVRAQALLQRHPGLDVDAGQPRLSTGPVPATMPLPCACCASWRRPCPPGPPWGHGAAC 100 Query: 391 TCPGG 405 CP G Sbjct: 101 CCPPG 105
>gi|22296332|dbj|BAC10103.1| alcohol dehydrogenase-like protein [Oryza sativa (japonica cultivar-group)] Length = 341 Score = 31.2 bits (69), Expect = 8.0 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -3 Query: 553 VNGHNLVVDGGFTTHKGDDNRMN**HA 473 + GHNLVVDGGFT K R+N HA Sbjct: 319 ITGHNLVVDGGFTVGK----RLNFAHA 341
>gi|22985250|gb|ZP_00030374.1| hypothetical protein [Burkholderia fungorum] Length = 547 Score = 31.2 bits (69), Expect = 8.0 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -2 Query: 416 RFERPPGQVELGF*PCVRPAGQGTVSGRQFLWGVGLPKGNGGVQR 282 R P G GF RP G G GR+F G G P GNGG R Sbjct: 456 RKSAPSGNGRPGFGGRGRPGG-GNGGGRRFGSGSGKPAGNGGAAR 499
>gi|15230558|ref|NP_190736.1| short-chain alcohol dehydrogenase-like protein; protein id: At3g51680.1 [Arabidopsis thaliana] gi|11250813|pir||T46064 short-chain alcohol dehydrogenase-like protein - Arabidopsis thaliana gi|6580150|emb|CAB63154.1| short-chain alcohol dehydrogenase-like protein [Arabidopsis thaliana] Length = 303 Score = 31.2 bits (69), Expect = 8.0 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 553 VNGHNLVVDGGFTT 512 VNGHNLVVDGG TT Sbjct: 283 VNGHNLVVDGGVTT 296
>gi|18138077|emb|CAD20601.2| putative ES protein [Ostertagia ostertagi] Length = 176 Score = 31.2 bits (69), Expect = 8.0 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = +3 Query: 165 LGTVG---SLRPTFVSARRVSLAVKLPSAFALEDQCPSGPRKPL-HASVTFWEAYAP*KL 332 LG VG S PT R+ K P A L+D+ P PR+P+ H + + A+ KL Sbjct: 81 LGMVGWTPSSEPTEAPERKPVATFKTPVAVVLDDEVPPSPREPVPHRTAGYGLAHQKRKL 140 Query: 333 ST*D 344 D Sbjct: 141 QIPD 144
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 397,333,461 Number of Sequences: 1247039 Number of extensions: 8646583 Number of successful extensions: 21675 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 20755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21656 length of database: 397,579,747 effective HSP length: 115 effective length of database: 254,170,262 effective search space used: 17537748078 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)