Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039716020-03562-30306 Query= (243 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039716020-03562-30306
Query= (243 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|10140669|gb|AAG13504.1|AC068924_9 putative cytochrome P4... 68 3e-11 gi|10140665|gb|AAG13500.1|AC068924_5 putative cytochrome P4... 64 4e-10 gi|10140690|gb|AAG13525.1|AC068924_30 putative cytochrome P... 62 2e-09 gi|10140672|gb|AAG13507.1|AC068924_12 putative cytochrome P... 62 2e-09 gi|10140663|gb|AAG13498.1|AC068924_3 putative cytochrome P4... 61 3e-09 gi|10140687|gb|AAG13522.1|AC068924_27 putative cytochrome P... 59 2e-08 gi|10140682|gb|AAG13517.1|AC068924_22 putative cytochrome P... 59 2e-08 gi|10140671|gb|AAG13506.1|AC068924_11 putative cytochrome P... 54 7e-07 gi|15224379|ref|NP_178922.1| cytochrome p450, putative; pro... 51 4e-06 gi|15450601|gb|AAK96572.1| At1g64950/F13O11_25 [Arabidopsis... 50 6e-06 gi|15217801|ref|NP_176675.1| cytochrome p450, putative; pro... 50 6e-06 gi|15217798|ref|NP_176673.1| cytochrome p450, putative; pro... 50 6e-06 gi|15217771|ref|NP_176670.1| cytochrome p450, putative; pro... 50 6e-06 gi|1432145|gb|AAB67854.1| cytochrome P450 [Arabidopsis thal... 50 6e-06 gi|15217800|ref|NP_176674.1| cytochrome p450, putative; pro... 50 7e-06 gi|9757853|dbj|BAB08487.1| cytochrome P450-like protein [Ar... 48 3e-05 gi|15240223|ref|NP_200940.1| cytochrome p450 family; protei... 48 3e-05 gi|10140662|gb|AAG13497.1|AC068924_2 putative cytochrome P4... 46 1e-04 gi|18464017|gb|AAL73064.1|AC090873_10 Putative cytochrome P... 40 0.008 gi|15983414|gb|AAL11575.1|AF424581_1 AT3g03470/T21P5_11 [Ar... 40 0.008 gi|15228566|ref|NP_186997.1| cytochrome p450, putative; pro... 40 0.008 gi|584867|sp|P37124|C772_SOLME Cytochrome P450 77A2 (CYPLXX... 39 0.022 gi|13661764|gb|AAK38089.1| putative cytochrome P450 [Lolium... 38 0.029 gi|20160664|dbj|BAB89608.1| putative cytochrome P450 [Oryza... 38 0.038 gi|542070|pir||S41599 cytochrome P450 77A1 - eggplant (frag... 37 0.050 gi|584866|sp|P37123|C771_SOLME Cytochrome P450 77A1 (CYPLXX... 37 0.050 gi|21595357|gb|AAM66094.1| cytochrom P450-like protein [Ara... 37 0.050 gi|15238249|ref|NP_196086.1| cytochrome p450, putative; pro... 37 0.050 gi|7446234|pir||S35180 cytochrome P450 (clone 15) - Madagas... 37 0.065 gi|15228331|ref|NP_187668.1| cytochrome p450, putative; pro... 35 0.19 gi|5915821|sp|O48928|C773_SOYBN Cytochrome P450 77A3 >gi|74... 30 6.1 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|10140669|gb|AAG13504.1|AC068924_9 putative cytochrome P4... 68 3e-11 gi|10140665|gb|AAG13500.1|AC068924_5 putative cytochrome P4... 64 4e-10 gi|10140690|gb|AAG13525.1|AC068924_30 putative cytochrome P... 62 2e-09 gi|10140672|gb|AAG13507.1|AC068924_12 putative cytochrome P... 62 2e-09 gi|10140663|gb|AAG13498.1|AC068924_3 putative cytochrome P4... 61 3e-09 gi|10140687|gb|AAG13522.1|AC068924_27 putative cytochrome P... 59 2e-08 gi|10140682|gb|AAG13517.1|AC068924_22 putative cytochrome P... 59 2e-08 gi|10140671|gb|AAG13506.1|AC068924_11 putative cytochrome P... 54 7e-07 gi|15224379|ref|NP_178922.1| cytochrome p450, putative; pro... 51 4e-06 gi|15450601|gb|AAK96572.1| At1g64950/F13O11_25 [Arabidopsis... 50 6e-06 gi|15217801|ref|NP_176675.1| cytochrome p450, putative; pro... 50 6e-06 gi|15217798|ref|NP_176673.1| cytochrome p450, putative; pro... 50 6e-06 gi|15217771|ref|NP_176670.1| cytochrome p450, putative; pro... 50 6e-06 gi|1432145|gb|AAB67854.1| cytochrome P450 [Arabidopsis thal... 50 6e-06 gi|15217800|ref|NP_176674.1| cytochrome p450, putative; pro... 50 7e-06 gi|9757853|dbj|BAB08487.1| cytochrome P450-like protein [Ar... 48 3e-05 gi|15240223|ref|NP_200940.1| cytochrome p450 family; protei... 48 3e-05 gi|10140662|gb|AAG13497.1|AC068924_2 putative cytochrome P4... 46 1e-04 gi|18464017|gb|AAL73064.1|AC090873_10 Putative cytochrome P... 40 0.008 gi|15983414|gb|AAL11575.1|AF424581_1 AT3g03470/T21P5_11 [Ar... 40 0.008 gi|15228566|ref|NP_186997.1| cytochrome p450, putative; pro... 40 0.008 gi|584867|sp|P37124|C772_SOLME Cytochrome P450 77A2 (CYPLXX... 39 0.022 gi|13661764|gb|AAK38089.1| putative cytochrome P450 [Lolium... 38 0.029 gi|20160664|dbj|BAB89608.1| putative cytochrome P450 [Oryza... 38 0.038 gi|542070|pir||S41599 cytochrome P450 77A1 - eggplant (frag... 37 0.050 gi|584866|sp|P37123|C771_SOLME Cytochrome P450 77A1 (CYPLXX... 37 0.050 gi|21595357|gb|AAM66094.1| cytochrom P450-like protein [Ara... 37 0.050 gi|15238249|ref|NP_196086.1| cytochrome p450, putative; pro... 37 0.050 gi|7446234|pir||S35180 cytochrome P450 (clone 15) - Madagas... 37 0.065 gi|15228331|ref|NP_187668.1| cytochrome p450, putative; pro... 35 0.19 gi|5915821|sp|O48928|C773_SOYBN Cytochrome P450 77A3 >gi|74... 30 6.1
>gi|10140669|gb|AAG13504.1|AC068924_9 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 523 Score = 67.8 bits (164), Expect = 3e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAE 143 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMA+ Sbjct: 480 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAK 512
>gi|10140665|gb|AAG13500.1|AC068924_5 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 537 Score = 64.3 bits (155), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAE 143 FVANMV EFEWKEVAGDEVDFAE++EFTTVMA+ Sbjct: 491 FVANMVKEFEWKEVAGDEVDFAERLEFTTVMAK 523
>gi|10140690|gb|AAG13525.1|AC068924_30 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 514 Score = 62.0 bits (149), Expect = 2e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAE 143 FVANMV EFEW+E+AG+EVDFAEK+EFTTVMA+ Sbjct: 470 FVANMVREFEWREIAGEEVDFAEKLEFTTVMAK 502
>gi|10140672|gb|AAG13507.1|AC068924_12 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 516 Score = 61.6 bits (148), Expect = 2e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAE 143 FVANMV EFEWKEVAGDEV+FAEK EFTTVMA+ Sbjct: 472 FVANMVREFEWKEVAGDEVEFAEKREFTTVMAK 504
>gi|10140663|gb|AAG13498.1|AC068924_3 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 643 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAE 143 FVANMV EFEWKEVAGDEVDFAEK EF TVMA+ Sbjct: 474 FVANMVREFEWKEVAGDEVDFAEKREFNTVMAK 506
>gi|10140687|gb|AAG13522.1|AC068924_27 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 520 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAE 143 FVAN+V EFEWKEVAGDEVD EK EFTTVMA+ Sbjct: 478 FVANLVKEFEWKEVAGDEVDLTEKNEFTTVMAK 510
>gi|10140682|gb|AAG13517.1|AC068924_22 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 520 Score = 58.5 bits (140), Expect = 2e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAE 143 FV +MV EFEWKEVAGDEV+FAEK+EFTT MA+ Sbjct: 452 FVGSMVMEFEWKEVAGDEVEFAEKLEFTTAMAK 484
>gi|10140671|gb|AAG13506.1|AC068924_11 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 512 Score = 53.5 bits (127), Expect = 7e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAE 143 FV +MV EFEWKEV G EV+FAEK EFTTVMA+ Sbjct: 469 FVGSMVMEFEWKEVEGHEVEFAEKREFTTVMAK 501
>gi|15224379|ref|NP_178922.1| cytochrome p450, putative; protein id: At2g12190.1 [Arabidopsis thaliana] gi|25282595|pir||E84501 probable cytochrome P450 [imported] - Arabidopsis thaliana gi|20197476|gb|AAM15091.1| putative cytochrome p450 [Arabidopsis thaliana] gi|20198022|gb|AAM15354.1| putative cytochrome p450 [Arabidopsis thaliana] Length = 512 Score = 50.8 bits (120), Expect = 4e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VANMV EFEWKEV G EVD EK EFT VM Sbjct: 468 YVANMVREFEWKEVQGHEVDLTEKFEFTVVM 498
>gi|15450601|gb|AAK96572.1| At1g64950/F13O11_25 [Arabidopsis thaliana] Length = 510 Score = 50.4 bits (119), Expect = 6e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VANMV EF+WKEV G EVD EK+EFT VM Sbjct: 466 YVANMVREFDWKEVQGHEVDLTEKLEFTVVM 496
>gi|15217801|ref|NP_176675.1| cytochrome p450, putative; protein id: At1g64950.1, supported by cDNA: gi_14334809, supported by cDNA: gi_15293196, supported by cDNA: gi_15450600 [Arabidopsis thaliana] gi|25282573|pir||A96673 probable cytochrome P450 F13O11.25 [imported] - Arabidopsis thaliana gi|5042430|gb|AAD38269.1|AC006193_25 Putative cytochrome P450 [Arabidopsis thaliana] gi|14334810|gb|AAK59583.1| putative cytochrome p450 protein [Arabidopsis thaliana] gi|15293197|gb|AAK93709.1| putative cytochrome p450 protein [Arabidopsis thaliana] Length = 510 Score = 50.4 bits (119), Expect = 6e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VANMV EF+WKEV G EVD EK+EFT VM Sbjct: 466 YVANMVREFDWKEVQGHEVDLTEKLEFTVVM 496
>gi|15217798|ref|NP_176673.1| cytochrome p450, putative; protein id: At1g64930.1 [Arabidopsis thaliana] gi|25282571|pir||G96672 hypothetical protein F13O11.23 [imported] - Arabidopsis thaliana gi|5042428|gb|AAD38267.1|AC006193_23 Putative cytochrome P450 [Arabidopsis thaliana] Length = 511 Score = 50.4 bits (119), Expect = 6e-06 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VANMV EF+WKEV G EVD EK+EFT +M Sbjct: 467 YVANMVREFQWKEVEGHEVDLTEKVEFTVIM 497
>gi|15217771|ref|NP_176670.1| cytochrome p450, putative; protein id: At1g64900.1, supported by cDNA: gi_1432144 [Arabidopsis thaliana] gi|13878919|sp|Q42602|C892_ARATH Cytochrome P450 89A2 (CYPLXXXIX) (ATH 6-1) gi|25282570|pir||D96672 probable Cytochrome P450 F13O11.20 [imported] - Arabidopsis thaliana gi|5042425|gb|AAD38264.1|AC006193_20 Putative Cytochrome P450 [Arabidopsis thaliana] Length = 506 Score = 50.4 bits (119), Expect = 6e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VANMV EF+WKEV G EVD EK+EFT VM Sbjct: 462 YVANMVREFQWKEVQGHEVDLTEKLEFTVVM 492
>gi|1432145|gb|AAB67854.1| cytochrome P450 [Arabidopsis thaliana] Length = 506 Score = 50.4 bits (119), Expect = 6e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VANMV EF+WKEV G EVD EK+EFT VM Sbjct: 462 YVANMVREFQWKEVEGHEVDLTEKLEFTVVM 492
>gi|15217800|ref|NP_176674.1| cytochrome p450, putative; protein id: At1g64940.1 [Arabidopsis thaliana] gi|25282572|pir||H96672 probable cytochrome P450 F13O11.24 [imported] - Arabidopsis thaliana gi|5042429|gb|AAD38268.1|AC006193_24 Putative cytochrome P450 [Arabidopsis thaliana] Length = 511 Score = 50.1 bits (118), Expect = 7e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VANMV EFEW+EV G EVD EK+EFT VM Sbjct: 467 YVANMVREFEWQEVQGHEVDLTEKLEFTVVM 497
>gi|9757853|dbj|BAB08487.1| cytochrome P450-like protein [Arabidopsis thaliana] Length = 483 Score = 48.1 bits (113), Expect = 3e-05 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 FV N+V EFEWKEV G EVD +EK EFT VM Sbjct: 432 FVVNLVKEFEWKEVEGYEVDLSEKWEFTVVM 462
>gi|15240223|ref|NP_200940.1| cytochrome p450 family; protein id: At5g61320.1 [Arabidopsis thaliana] Length = 497 Score = 48.1 bits (113), Expect = 3e-05 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 FV N+V EFEWKEV G EVD +EK EFT VM Sbjct: 446 FVVNLVKEFEWKEVEGYEVDLSEKWEFTVVM 476
>gi|10140662|gb|AAG13497.1|AC068924_2 putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 203 Score = 46.2 bits (108), Expect = 1e-04 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKI 167 FVANMV EFEWK V GD+VDFAEK+ Sbjct: 146 FVANMVREFEWKAVVGDKVDFAEKL 170
>gi|18464017|gb|AAL73064.1|AC090873_10 Putative cytochrome P450 [Oryza sativa] Length = 530 Score = 40.0 bits (92), Expect = 0.008 Identities = 19/32 (59%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDF-AEKIEFTTVM 149 FVANMV+ FEW+ G+ VD EK+EFT VM Sbjct: 484 FVANMVAAFEWRAAEGEAVDVDGEKLEFTVVM 515
>gi|15983414|gb|AAL11575.1|AF424581_1 AT3g03470/T21P5_11 [Arabidopsis thaliana] Length = 511 Score = 40.0 bits (92), Expect = 0.008 Identities = 17/31 (54%), Positives = 25/31 (80%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VAN+V +FEWK V G+EVD +EK +F T++ Sbjct: 467 YVANLVWKFEWKCVEGEEVDLSEKQQFITMV 497
>gi|15228566|ref|NP_186997.1| cytochrome p450, putative; protein id: At3g03470.1, supported by cDNA: gi_15983413 [Arabidopsis thaliana] gi|6017105|gb|AAF01588.1|AC009895_9 putative cytochrome P450 [Arabidopsis thaliana] Length = 511 Score = 40.0 bits (92), Expect = 0.008 Identities = 17/31 (54%), Positives = 25/31 (80%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +VAN+V +FEWK V G+EVD +EK +F T++ Sbjct: 467 YVANLVWKFEWKCVEGEEVDLSEKQQFITMV 497
>gi|584867|sp|P37124|C772_SOLME Cytochrome P450 77A2 (CYPLXXVIIA2) (P-450EG5) gi|542071|pir||S41598 cytochrome P450 77A2 - eggplant gi|438241|emb|CAA50646.1| CYP77A2 [Solanum melongena] Length = 511 Score = 38.5 bits (88), Expect = 0.022 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = -3 Query: 238 VANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 +A +V EFEW + VDF EK+EFT VM Sbjct: 470 LARLVQEFEWADPENTRVDFTEKLEFTVVM 499
>gi|13661764|gb|AAK38089.1| putative cytochrome P450 [Lolium rigidum] Length = 498 Score = 38.1 bits (87), Expect = 0.029 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -3 Query: 241 FVANMVSEFEWKE-VAGDEVDFAEKIEFTTVM 149 FVA MV + EW+ V G+EVD AE ++FTTV+ Sbjct: 450 FVARMVMDVEWRPPVEGEEVDMAETLDFTTVI 481
>gi|20160664|dbj|BAB89608.1| putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] gi|21104832|dbj|BAB93417.1| putative cytochrome P450 [Oryza sativa (japonica cultivar-group)] Length = 524 Score = 37.7 bits (86), Expect = 0.038 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGD---EVDFAEKIEFTTVMAE 143 FVANMV EFEW V GD ++ AE+ EFT +M + Sbjct: 477 FVANMVREFEWGMVDGDCGGGINLAERPEFTVIMEQ 512
>gi|542070|pir||S41599 cytochrome P450 77A1 - eggplant (fragment) Length = 499 Score = 37.4 bits (85), Expect = 0.050 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -3 Query: 238 VANMVSEFEWKEVAGD-EVDFAEKIEFTTVM 149 +A MV EFEW G+ +VDF+EK+EFT VM Sbjct: 457 LARMVQEFEWFAYPGNNKVDFSEKLEFTVVM 487
>gi|584866|sp|P37123|C771_SOLME Cytochrome P450 77A1 (CYPLXXVIIA1) (P-450EG6) gi|438243|emb|CAA50647.1| P450 hydroxylase [Solanum melongena] Length = 499 Score = 37.4 bits (85), Expect = 0.050 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -3 Query: 238 VANMVSEFEWKEVAGD-EVDFAEKIEFTTVM 149 +A MV EFEW G+ +VDF+EK+EFT VM Sbjct: 457 LARMVQEFEWFAYPGNNKVDFSEKLEFTVVM 487
>gi|21595357|gb|AAM66094.1| cytochrom P450-like protein [Arabidopsis thaliana] Length = 512 Score = 37.4 bits (85), Expect = 0.050 Identities = 18/31 (58%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -3 Query: 238 VANMVSEFEW-KEVAGDEVDFAEKIEFTTVM 149 +A MV EFEW G E+DFA K+EFT VM Sbjct: 470 LARMVQEFEWCAHPPGSEIDFAGKLEFTVVM 500
>gi|15238249|ref|NP_196086.1| cytochrome p450, putative; protein id: At5g04660.1, supported by cDNA: 7867. [Arabidopsis thaliana] gi|11249381|pir||T48462 cytochrome P450-like protein - Arabidopsis thaliana gi|7413528|emb|CAB86008.1| cytochrom P450-like protein [Arabidopsis thaliana] Length = 512 Score = 37.4 bits (85), Expect = 0.050 Identities = 18/31 (58%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -3 Query: 238 VANMVSEFEW-KEVAGDEVDFAEKIEFTTVM 149 +A MV EFEW G E+DFA K+EFT VM Sbjct: 470 LARMVQEFEWCAHPPGSEIDFAGKLEFTVVM 500
>gi|7446234|pir||S35180 cytochrome P450 (clone 15) - Madagascar periwinkle (fragment) gi|395326|emb|CAA49442.1| cytochrome P450 [Catharanthus roseus] Length = 60 Score = 37.0 bits (84), Expect = 0.065 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -3 Query: 241 FVANMVSEFEWKEVAGDEVDFAEKIEFTTVM 149 FVAN++ FEW + G+++D +EK EFT M Sbjct: 15 FVANLIWYFEWTAMDGNDIDLSEKQEFTICM 45
>gi|15228331|ref|NP_187668.1| cytochrome p450, putative; protein id: At3g10570.1 [Arabidopsis thaliana] gi|8567787|gb|AAF76359.1| cytochrome P450, putative [Arabidopsis thaliana] gi|12322793|gb|AAG51390.1|AC011560_22 putative cytochrome P450; 45201-43660 [Arabidopsis thaliana] Length = 513 Score = 35.4 bits (80), Expect = 0.19 Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -3 Query: 238 VANMVSEFEWKEVAGD-EVDFAEKIEFTTVM 149 +A MV EFEW + E+DFA K+EFT VM Sbjct: 471 LAKMVQEFEWSAYPPESEIDFAGKLEFTVVM 501
>gi|5915821|sp|O48928|C773_SOYBN Cytochrome P450 77A3 gi|7430618|pir||T05948 cytochrome P450 77A3p - soybean gi|2739010|gb|AAB94593.1| CYP77A3p [Glycine max] Length = 513 Score = 30.4 bits (67), Expect = 6.1 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 238 VANMVSEFEWKEVAGDE-VDFAEKIEFTTVMAE 143 +A MV EFEW ++ +DF K EFT VM E Sbjct: 465 MARMVQEFEWGAYPPEKKMDFTGKWEFTVVMKE 497
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 130,199,464 Number of Sequences: 1247039 Number of extensions: 1884928 Number of successful extensions: 4511 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 4410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4510 length of database: 397,579,747 effective HSP length: 56 effective length of database: 327,745,563 effective search space used: 7865893512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)