Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039749856-07683-22060 Query= (270 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039749856-07683-22060
Query= (270 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|14029035|gb|AAK52576.1|AC079685_7 Putative peptide/amino... 33 0.70 gi|23131978|gb|ZP_00113763.1| hypothetical protein [Prochlo... 31 3.5 gi|15229689|ref|NP_190587.1| putative protein; protein id: ... 31 4.5 gi|9366817|emb|CAB95579.1| conserved hypothetical protein [... 31 4.5 gi|15806010|ref|NP_294711.1| DNA-binding response regulator... 30 5.9 gi|23481355|gb|EAA17659.1| Cyclin, putative [Plasmodium yoe... 30 7.7 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|14029035|gb|AAK52576.1|AC079685_7 Putative peptide/amino... 33 0.70 gi|23131978|gb|ZP_00113763.1| hypothetical protein [Prochlo... 31 3.5 gi|15229689|ref|NP_190587.1| putative protein; protein id: ... 31 4.5 gi|9366817|emb|CAB95579.1| conserved hypothetical protein [... 31 4.5 gi|15806010|ref|NP_294711.1| DNA-binding response regulator... 30 5.9 gi|23481355|gb|EAA17659.1| Cyclin, putative [Plasmodium yoe... 30 7.7
>gi|14029035|gb|AAK52576.1|AC079685_7 Putative peptide/amino acid transporter [Oryza sativa] Length = 235 Score = 33.5 bits (75), Expect = 0.70 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 22/87 (25%) Frame = -2 Query: 248 EINRWVIDLLSYTITPTTSVDELGLHPLDVLQKSV-------------RGSPNVRR---- 120 E+N+ V+ +S + + + LHPLD+ +KS+ RG R Sbjct: 121 EVNKMVLRFISPSCKTPPAKEHRALHPLDLFRKSLLSGQHHRPRGDQGRGGGGAARRDDR 180 Query: 119 -----STEGSLSCMPSAAELREAGIRF 54 E + + SAAEL EAGIRF Sbjct: 181 RHDDDEEEANGGIIRSAAELYEAGIRF 207
>gi|23131978|gb|ZP_00113763.1| hypothetical protein [Prochlorococcus marinus str. MIT 9313] Length = 222 Score = 31.2 bits (69), Expect = 3.5 Identities = 20/67 (29%), Positives = 31/67 (46%) Frame = +1 Query: 13 KLTVPANPEPSLTSKRIPASRSSAAEGIQLRDPSVDLRTFGLPRTLF*RTSNGWSPNSST 192 KL +PA P+P L +R+PA + A G+ + T L L GW S Sbjct: 106 KLPLPAGPDPDLWRQRVPAPLAPVAAGLAFGLAASPCTTPVLAVLL------GWIAQSGQ 159 Query: 193 DVVGVMV 213 +VG+++ Sbjct: 160 PLVGIVL 166
>gi|15229689|ref|NP_190587.1| putative protein; protein id: At3g50180.1 [Arabidopsis thaliana] gi|11357345|pir||T45564 hypothetical protein F11C1.20 - Arabidopsis thaliana gi|6523029|emb|CAB62297.1| putative protein [Arabidopsis thaliana] Length = 588 Score = 30.8 bits (68), Expect = 4.5 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 6/65 (9%) Frame = -2 Query: 206 TPTTSVDELGLHPLDVLQKSV-----RGSPNVRRSTEGSLS-CMPSAAELREAGIRFEVS 45 +P V LH LDV +S+ G N R + L +P+ ELR+AG +F+++ Sbjct: 360 SPPRGVSNGELHCLDVFHRSLLFPRSSGKANYSRVADKHLQRVIPTVTELRDAGFKFKLN 419 Query: 44 EGSGF 30 + F Sbjct: 420 KTDRF 424
>gi|9366817|emb|CAB95579.1| conserved hypothetical protein [Trypanosoma brucei] Length = 1249 Score = 30.8 bits (68), Expect = 4.5 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +1 Query: 7 RSKLTVPANPEPSLTSKRIPASRSSAAEGIQL-RDPSVDLRTFGLPRT 147 R+ ++P P P+L+S R PA++S A+ + PS R+ PRT Sbjct: 190 RTSTSIPVQPLPTLSSVRPPATKSPASSRPAIATSPSGTARSLRTPRT 237
>gi|15806010|ref|NP_294711.1| DNA-binding response regulator [Deinococcus radiodurans] gi|7471836|pir||E75450 DNA-binding response regulator - Deinococcus radiodurans (strain R1) gi|6458715|gb|AAF10563.1|AE001951_3 DNA-binding response regulator [Deinococcus radiodurans] Length = 239 Score = 30.4 bits (67), Expect = 5.9 Identities = 21/73 (28%), Positives = 32/73 (43%) Frame = -2 Query: 254 HREINRWVIDLLSYTITPTTSVDELGLHPLDVLQKSVRGSPNVRRSTEGSLSCMPSAAEL 75 H I R V++ S TPT D+L L+VL+ + G N + L P ++ Sbjct: 150 HPSIARKVLERFSVASTPTPPEDDLSPRELEVLRVAASGRTN--KEIARDLDISPRTVQV 207 Query: 74 REAGIRFEVSEGS 36 A I ++ GS Sbjct: 208 HLANIFSKLGVGS 220
>gi|23481355|gb|EAA17659.1| Cyclin, putative [Plasmodium yoelii yoelii] Length = 503 Score = 30.0 bits (66), Expect = 7.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 220 FPIPSHLPRLSMSWGSIHWTFFRKASVVVQTSEGQLKGLSAVCLPL 83 F + +H+P + +S S W FF + + +G K +A CL L Sbjct: 386 FNLVNHIPEIDISTISCAWVFFERLVIKGYVHKGNRKLYAATCLIL 431
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 195,467,751 Number of Sequences: 1247039 Number of extensions: 3726758 Number of successful extensions: 11974 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 11835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11971 length of database: 397,579,747 effective HSP length: 65 effective length of database: 316,522,212 effective search space used: 7596533088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)