Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039750466-012563-25834 Query= (290 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039750466-012563-25834
Query= (290 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|548493|sp|P35339|PGLT_MAIZE EXOPOLYGALACTURONASE PRECURS... 32 1.5 gi|944922|gb|AAC49038.1| beta-glucosidase 31 4.4 gi|15890830|ref|NP_356502.1| AGR_L_1417p [Agrobacterium tum... 30 9.8 gi|17937841|ref|NP_534630.1| conserved hypothetical protein... 30 9.8 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|548493|sp|P35339|PGLT_MAIZE EXOPOLYGALACTURONASE PRECURS... 32 1.5 gi|944922|gb|AAC49038.1| beta-glucosidase 31 4.4 gi|15890830|ref|NP_356502.1| AGR_L_1417p [Agrobacterium tum... 30 9.8 gi|17937841|ref|NP_534630.1| conserved hypothetical protein... 30 9.8
>gi|548493|sp|P35339|PGLT_MAIZE EXOPOLYGALACTURONASE PRECURSOR (EXOPG) (PECTINASE) (GALACTURAN 1,4-ALPHA-GALACTURONIDASE) gi|629854|pir||S30067 polygalacturonase - maize gi|288612|emb|CAA47052.1| polygalacturonase [Zea mays] Length = 410 Score = 32.3 bits (72), Expect = 1.5 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = +2 Query: 122 ITLKMPPCPHQLCTLREETTPGAAEACLSAMDITFSNLTGHLSMQ-----ICTRIYPC 280 I + M CP++LCT GA++ ++ D+TF N+TG S +CT PC Sbjct: 320 IIIDMKYCPNKLCTAN-----GASK--VTVKDVTFKNITGTSSTPEAVNLLCTAKIPC 370
>gi|944922|gb|AAC49038.1| beta-glucosidase Length = 420 Score = 30.8 bits (68), Expect = 4.4 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +2 Query: 20 KHRSATNTTAICYVYHMLIADCYGTGDTDYRPATITLKMPPCPHQLCTLREETT 181 KH A YVY + D G G+T + AT+T MPP + E+TT Sbjct: 31 KHHQHKRAVAYEYVYVTITVD--GNGNTIEQSATLTTTMPPVSTPETSSDEDTT 82
>gi|15890830|ref|NP_356502.1| AGR_L_1417p [Agrobacterium tumefaciens] gi|25379748|pir||E98220 hypothetical protein AGR_L_1417 [imported] - Agrobacterium tumefaciens (strain C58, Cereon) gi|15159119|gb|AAK89287.1| AGR_L_1417p [Agrobacterium tumefaciens str. C58 (Cereon)] Length = 631 Score = 29.6 bits (65), Expect = 9.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 133 DAPVPTSTLHLTGGNDAWCRRSVPICHGYYL 225 D P+P LHLTGG R + H YL Sbjct: 49 DRPLPFLCLHLTGGTKNLAARDIAAAHASYL 79
>gi|17937841|ref|NP_534630.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] gi|25379750|pir||AD3066 conserved hypothetical protein Atu4146 [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gi|17742600|gb|AAL44946.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 625 Score = 29.6 bits (65), Expect = 9.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 133 DAPVPTSTLHLTGGNDAWCRRSVPICHGYYL 225 D P+P LHLTGG R + H YL Sbjct: 43 DRPLPFLCLHLTGGTKNLAARDIAAAHASYL 73
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 230,673,880 Number of Sequences: 1247039 Number of extensions: 4645078 Number of successful extensions: 9582 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9581 length of database: 397,579,747 effective HSP length: 72 effective length of database: 307,792,939 effective search space used: 7387030536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)