Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039752842-02257-27664 Query= (238 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039752842-02257-27664
Query= (238 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|17554414|ref|NP_499030.1| PaTched Related PTR-9 (ptr-9) ... 32 1.6 gi|25091408|sp|Q00357|TOXA_COCCA Putative HC-toxin efflux c... 32 2.8 gi|23485670|gb|EAA20525.1| hypothetical protein [Plasmodium... 32 2.8 gi|3098512|gb|AAC27701.1| glucose permease [Corynebacterium... 31 4.7 gi|15623988|dbj|BAB68042.1| putative alliinase [Oryza sativ... 30 8.0 gi|15623991|dbj|BAB68045.1| putative alliinase [Oryza sativ... 30 8.0 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|17554414|ref|NP_499030.1| PaTched Related PTR-9 (ptr-9) ... 32 1.6 gi|25091408|sp|Q00357|TOXA_COCCA Putative HC-toxin efflux c... 32 2.8 gi|23485670|gb|EAA20525.1| hypothetical protein [Plasmodium... 32 2.8 gi|3098512|gb|AAC27701.1| glucose permease [Corynebacterium... 31 4.7 gi|15623988|dbj|BAB68042.1| putative alliinase [Oryza sativ... 30 8.0 gi|15623991|dbj|BAB68045.1| putative alliinase [Oryza sativ... 30 8.0
>gi|17554414|ref|NP_499030.1| PaTched Related PTR-9 (ptr-9) [Caenorhabditis elegans] gi|465915|sp|Q03602|YMB5_CAEEL Hypothetical 47.0 kDa protein F54G8.5 in chromosome III gi|280547|pir||S28276 hypothetical protein F54G8.5 - Caenorhabditis elegans gi|3877604|emb|CAA79560.1| C. elegans ptr-9 protein (corresponding sequence F54G8.5) [Caenorhabditis elegans] Length = 413 Score = 32.3 bits (72), Expect = 1.6 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = -3 Query: 200 ACSVLFNFLWCFWSSIHALMMLVCRVSLQGFPPFFCTYESSGFPRESHMRSNRSFF 33 A ++LF FL+ + +A+M L CR + G P FC YE + P E+ + +S F Sbjct: 53 AMAILFMFLFQV-TFFNAVMSLCCRREVSGKHPVFCCYEITP-PEETQVLEKQSNF 106
>gi|25091408|sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA gi|1063421|gb|AAB36607.1| toxin pump Length = 548 Score = 31.6 bits (70), Expect = 2.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 173 WCFWSSIHALMMLVCRVSLQGFPPFFCTYESSGFPR 66 WCFW ++ + VC + L F P TY +SG PR Sbjct: 204 WCFWINL-PIGAAVCAILLFFFHPPRSTYSASGVPR 238
>gi|23485670|gb|EAA20525.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 3623 Score = 31.6 bits (70), Expect = 2.8 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +1 Query: 73 KPLDSYVQKNGGNPCRLTRQTSIISAWILDQKHHKKLKRTEQASNQPASTSTYIL 237 KP + +N N LT+ +SI+S D H KL+ + ASN+ + YI+ Sbjct: 908 KPTKNIDTQNNNNDILLTQDSSILST---DSDGHSKLRNSYCASNEEGYKNNYII 959
>gi|3098512|gb|AAC27701.1| glucose permease [Corynebacterium ammoniagenes] Length = 661 Score = 30.8 bits (68), Expect = 4.7 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 10/61 (16%) Frame = -1 Query: 187 SLISYG--VFGPVSMH**CLFAGSVYRGFHRF---SVHTNQVVFL-----VKVTCVLIGP 38 +L YG VF P+ M L A +Y+GF + +VH V FL + +T VLIGP Sbjct: 233 ALPDYGGNVFVPLIM---ALVAAGIYKGFQKIIPSAVHMVFVPFLTLLFTIPITAVLIGP 289 Query: 37 F 35 F Sbjct: 290 F 290
>gi|15623988|dbj|BAB68042.1| putative alliinase [Oryza sativa (japonica cultivar-group)] gi|20160894|dbj|BAB89832.1| putative alliinase [Oryza sativa (japonica cultivar-group)] Length = 485 Score = 30.0 bits (66), Expect = 8.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 164 WSSIHALMMLVCRVSLQGFPPFFCTY 87 W ++A++ R+SLQ PP +CTY Sbjct: 375 WRRLNAVVSRSTRISLQKMPPQYCTY 400
>gi|15623991|dbj|BAB68045.1| putative alliinase [Oryza sativa (japonica cultivar-group)] gi|20160897|dbj|BAB89835.1| putative alliinase [Oryza sativa (japonica cultivar-group)] Length = 484 Score = 30.0 bits (66), Expect = 8.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 164 WSSIHALMMLVCRVSLQGFPPFFCTY 87 W ++A++ R+SLQ PP +CTY Sbjct: 374 WRRLNAVVSRSTRISLQKIPPQYCTY 399
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 180,381,215 Number of Sequences: 1247039 Number of extensions: 3233423 Number of successful extensions: 7893 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 7755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7891 length of database: 397,579,747 effective HSP length: 54 effective length of database: 330,239,641 effective search space used: 7925751384 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)