Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039753453-07294-4915 Query= (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039753453-07294-4915
Query= (396 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|25044761|ref|XP_196551.1| hypothetical protein XP_196551... 51 4e-06 gi|482769|pir||A61144 probable flagellar protein (clone FCH... 37 0.069 gi|15807207|ref|NP_295936.1| conserved hypothetical protein... 32 2.2 gi|23488487|gb|EAA21331.1| hypothetical protein [Plasmodium... 29 4.5 gi|13242734|ref|NP_077398.1| protease [Bovine adenovirus D]... 30 8.4 gi|12847085|dbj|BAB27431.1| data source:MGD, source key:MGI... 30 8.4 gi|18079354|ref|NP_542374.1| cask-interacting protein 2 [Mu... 30 8.4 gi|7305615|ref|NP_038947.1| ubiquitin-specific protease 21;... 30 8.4 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|25044761|ref|XP_196551.1| hypothetical protein XP_196551... 51 4e-06 gi|482769|pir||A61144 probable flagellar protein (clone FCH... 37 0.069 gi|15807207|ref|NP_295936.1| conserved hypothetical protein... 32 2.2 gi|23488487|gb|EAA21331.1| hypothetical protein [Plasmodium... 29 4.5 gi|13242734|ref|NP_077398.1| protease [Bovine adenovirus D]... 30 8.4 gi|12847085|dbj|BAB27431.1| data source:MGD, source key:MGI... 30 8.4 gi|18079354|ref|NP_542374.1| cask-interacting protein 2 [Mu... 30 8.4 gi|7305615|ref|NP_038947.1| ubiquitin-specific protease 21;... 30 8.4
>gi|25044761|ref|XP_196551.1| hypothetical protein XP_196551 [Mus musculus] Length = 102 Score = 50.8 bits (120), Expect = 4e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +2 Query: 284 LPHPRKAAGAQITQS*HGEVVTINNNTGRF 373 LPHPRKAAGAQIT S GEVVT NNNTG F Sbjct: 63 LPHPRKAAGAQITHSRPGEVVTKNNNTGLF 92
>gi|482769|pir||A61144 probable flagellar protein (clone FCH-F8-4) - Trypanosoma cruzi (fragment) Length = 19 Score = 36.6 bits (83), Expect = 0.069 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 303 AFLGCGSRFSGSLSGIEP 250 AFLGC SRFSGS SG+EP Sbjct: 2 AFLGCSSRFSGSFSGVEP 19
>gi|15807207|ref|NP_295936.1| conserved hypothetical protein [Deinococcus radiodurans] gi|7471591|pir||F75301 conserved hypothetical protein - Deinococcus radiodurans (strain R1) gi|6460015|gb|AAF11760.1|AE002054_5 conserved hypothetical protein [Deinococcus radiodurans] Length = 371 Score = 31.6 bits (70), Expect = 2.2 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 68 RGAFIR*KA*RWAPPADPMIHDNSTDRTALVPA 166 RG F A W PPA P + + D+TAL+PA Sbjct: 216 RGRFAFTPAPDWCPPALPAVTGSGADKTALLPA 248
>gi|23488487|gb|EAA21331.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 105 Score = 28.9 bits (63), Expect(2) = 4.5 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -2 Query: 296 LDVVAVSQAXXXXXXXXXXXPVTTMVGPYPTIES 195 LDVVA+SQA PV M+G YP I+S Sbjct: 72 LDVVAISQAPSPESNSNSPLPVKAMLGQYPNIKS 105
Score = 20.8 bits (42), Expect(2) = 4.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 367 PGIVIYCHYL 338 P IVI CHYL Sbjct: 58 PYIVISCHYL 67
>gi|13242734|ref|NP_077398.1| protease [Bovine adenovirus D] gi|13129572|gb|AAC41021.2| protease [bovine adenovirus 4] Length = 201 Score = 29.6 bits (65), Expect = 8.4 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 185 RNLNDASPARGPCDPSSYHESSD 117 ++LN ASP+ P DPSS H++ D Sbjct: 147 QSLNGASPSLTPSDPSSLHKNQD 169
>gi|12847085|dbj|BAB27431.1| data source:MGD, source key:MGI:1353665, evidence:ISS~putative~ubiquitin specific protease 23 [Mus musculus] Length = 569 Score = 29.6 bits (65), Expect = 8.4 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 163 RHEGRAIRRVIMNHRISGRSPASSLLSNKCAPPGSRGLLHXISSR 29 R E +RR R+ G +LLS + PP S G H IS+R Sbjct: 145 RPEPPTLRRSTSLRRLGGFPGPPTLLSIRTEPPTSHGSFHMISAR 189
>gi|18079354|ref|NP_542374.1| cask-interacting protein 2 [Mus musculus] gi|17940760|gb|AAL49759.1|AF451978_1 cask-interacting protein 2 [Mus musculus] Length = 1201 Score = 29.6 bits (65), Expect = 8.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 158 RGPCDPSSYHESSDQRAEPSVKP 90 + PCDP S + QR+EPSV P Sbjct: 1021 QAPCDPPSASSNPPQRSEPSVLP 1043
>gi|7305615|ref|NP_038947.1| ubiquitin-specific protease 21; ubiquitin specific protease 23; EST W53272 [Mus musculus] gi|10720332|sp|Q9QZL6|UBPL_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 (Ubiquitin thiolesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) gi|5853115|gb|AAD54322.1|AF177759_1 ubiquitin specific protease 16 [Mus musculus] gi|18257320|gb|AAH21903.1| ubiquitin specific protease 23 [Mus musculus] Length = 566 Score = 29.6 bits (65), Expect = 8.4 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 163 RHEGRAIRRVIMNHRISGRSPASSLLSNKCAPPGSRGLLHXISSR 29 R E +RR R+ G +LLS + PP S G H IS+R Sbjct: 145 RPEPPTLRRSTSLRRLGGFPGPPTLLSIRTEPPTSHGSFHMISAR 189
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 292,161,585 Number of Sequences: 1247039 Number of extensions: 5668637 Number of successful extensions: 12659 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 12415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12659 length of database: 397,579,747 effective HSP length: 107 effective length of database: 264,146,574 effective search space used: 6339517776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)