Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039753661-09081-10136 Query= (547 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039753661-09081-10136
Query= (547 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|15226027|ref|NP_179097.1| unknown protein; protein id: A... 218 3e-56 gi|6648962|gb|AAF21309.1| seed maturation protein PM23 [Gly... 192 3e-48 gi|21536629|gb|AAM60961.1| seed maturation-like protein [Ar... 99 3e-20 gi|15242177|ref|NP_197001.1| seed maturation -like protein;... 99 3e-20 gi|17231303|ref|NP_487851.1| hypothetical protein [Nostoc s... 43 0.003 gi|15222486|ref|NP_176549.1| unknown protein; protein id: A... 42 0.004 gi|25404427|pir||B96661 unknown protein, 83181-85105 [impor... 42 0.004 gi|23043765|gb|ZP_00075004.1| hypothetical protein [Trichod... 40 0.021 gi|17232657|ref|NP_489205.1| hypothetical protein [Nostoc s... 40 0.021 gi|581306|emb|CAA53070.1| histidin kinase [Lactobacillus pl... 38 0.062 gi|16331041|ref|NP_441769.1| unknown protein [Synechocystis... 38 0.062 gi|23127708|gb|ZP_00109571.1| hypothetical protein [Nostoc ... 38 0.081 gi|23133544|gb|ZP_00115318.1| hypothetical protein [Synecho... 37 0.14 gi|23122461|gb|ZP_00104596.1| hypothetical protein [Prochlo... 37 0.14 gi|23613288|ref|NP_703610.1| hypothetical protein [Plasmodi... 37 0.18 gi|22299567|ref|NP_682814.1| ORF_ID:tll2024~hypothetical pr... 35 0.40 gi|16330948|ref|NP_441676.1| hypothetical protein [Synechoc... 35 0.40 gi|24414838|emb|CAD55651.1| hypothetical protein [Synechoco... 35 0.69 gi|23101971|gb|ZP_00088507.1| hypothetical protein [Azotoba... 35 0.69 gi|20090774|ref|NP_616849.1| conserved hypothetical protein... 35 0.69 gi|15668751|ref|NP_247550.1| aspartate kinase (lysC) [Metha... 34 0.90 gi|3766232|gb|AAC64407.1| kinectin [Vulpes vulpes] 34 0.90 gi|5869760|emb|CAA49829.1| p93 [Borrelia burgdorferi] 34 0.90 gi|23509492|ref|NP_702159.1| ribosomal protein L15, putativ... 34 0.90 gi|23478398|gb|EAA15496.1| hypothetical protein [Plasmodium... 34 1.2 gi|17230579|ref|NP_487127.1| hypothetical protein [Nostoc s... 34 1.2 gi|559543|gb|AAB58346.1| p93 antigen 33 1.5 gi|2120490|pir||S61463 p83/100 protein - Lyme disease spiro... 33 1.5 gi|2120487|pir||S61464 p83/100 protein - Lyme disease spiro... 33 1.5 gi|853736|emb|CAA54797.1| P97 protein [Borrelia burgdorferi] 33 1.5 gi|2120492|pir||I40090 p93 protein - Lyme disease spirochet... 33 1.5 gi|346275|pir||A45033 myelin transcription factor 1 - human... 33 1.5 gi|1272517|emb|CAA57125.1| p83/100 [Borrelia burgdorferi] 33 1.5 gi|7463732|pir||S61460 p83/100 protein - Lyme disease spiro... 33 1.5 gi|15595089|ref|NP_212878.1| antigen, p83/100 [Borrelia bur... 33 1.5 gi|5689437|dbj|BAA83002.1| KIAA1050 protein [Homo sapiens] 33 2.0 gi|1076739|pir||S53306 MADS box protein MADS1 - rice >gi|50... 33 2.0 gi|16078573|ref|NP_389392.1| similar to hypothetical protei... 33 2.0 gi|17975763|ref|NP_004526.1| myelin transcription factor 1;... 33 2.0 gi|9246936|gb|AAF86209.1| VrrB [Bacillus anthracis] 33 2.6 gi|9246917|gb|AAF86199.1|AF238885_2 VrrB [Bacillus anthracis] 33 2.6 gi|23482118|gb|EAA18193.1| hypothetical protein [Plasmodium... 33 2.6 gi|2147891|pir||S61461 p83/100 protein - Borrelia garinii (... 33 2.6 gi|7512169|pir||T14156 kinesin-related protein - African cl... 33 2.6 gi|9246944|gb|AAF86213.1| VrrB [Bacillus anthracis] 33 2.6 gi|9246946|gb|AAF86214.1| VrrB [Bacillus anthracis] 33 2.6 gi|20349232|ref|XP_111984.1| similar to RIKEN cDNA C330016H... 33 2.6 gi|9246930|gb|AAF86206.1| VrrB [Bacillus anthracis] 33 2.6 gi|9246926|gb|AAF86204.1| VrrB [Bacillus anthracis] 33 2.6 gi|15054439|gb|AAK77948.1| M protein [Streptococcus pyogenes] 32 3.4 gi|7959339|dbj|BAA96060.1| KIAA1536 protein [Homo sapiens] 32 3.4 gi|20094860|ref|NP_614707.1| Valyl-tRNA synthetase [Methano... 32 3.4 gi|23123455|gb|ZP_00105590.1| hypothetical protein [Prochlo... 32 3.4 gi|24647540|ref|NP_524896.2| CG11648-PB [Drosophila melanog... 32 3.4 gi|2120494|pir||I40141 p93 protein - Lyme disease spirochet... 32 3.4 gi|226723|prf||1604246A Abdominal-B gene 32 3.4 gi|321026|pir||A34220 homeotic protein Abd-B - fruit fly (D... 32 3.4 gi|14042878|dbj|BAB55428.1| unnamed protein product [Homo s... 32 3.4 gi|2120489|pir||S61462 p83/100 protein - Lyme disease spiro... 32 3.4 gi|17647993|ref|NP_524080.1| CG18492-PA [Drosophila melanog... 32 3.4 gi|6942201|gb|AAF32355.1|AF220353_1 kinesin-like kinetochor... 32 3.4 gi|24583666|ref|NP_524993.2| CG6392-PA [Drosophila melanoga... 32 3.4 gi|14149742|ref|NP_065949.1| KIAA1536 protein [Homo sapiens... 32 3.4 gi|1711385|sp|P54214|SFAS_DUNBI SF-assemblin >gi|1279362|em... 32 4.5 gi|26006217|dbj|BAC41451.1| mKIAA0835 protein [Mus musculus] 32 4.5 gi|23346429|ref|NP_032691.2| myelin transcription factor 1;... 32 4.5 gi|15149491|ref|NP_150373.1| E2F transcription factor 6 [Mu... 32 5.8 gi|17352153|gb|AAL38216.1|AF393249_1 E2F6a [Mus musculus] 32 5.8 gi|21306289|gb|AAM45941.1|AF487711_1 transcriptional repres... 32 5.8 gi|24943010|gb|AAM98022.2| Hypothetical protein F35D11.11d ... 32 5.8 gi|17533741|ref|NP_494820.1| M protein repeat containing pr... 32 5.8 gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanog... 32 5.8 gi|20151561|gb|AAM11140.1| LD14856p [Drosophila melanogaster] 32 5.8 gi|21241330|ref|NP_640912.1| conserved hypothetical protein... 32 5.8 gi|17533739|ref|NP_494819.1| M protein repeat containing pr... 32 5.8 gi|17533743|ref|NP_494821.1| M protein repeat containing pr... 32 5.8 gi|18391490|ref|NP_563924.1| putative nuclear matrix consti... 32 5.8 gi|24666890|ref|NP_649137.2| CG8789-PA [Drosophila melanoga... 32 5.8 gi|17352154|gb|AAL38217.1|AF393249_2 E2F6b [Mus musculus] >... 32 5.8 gi|436324|emb|CAA49311.1| p93 [Borrelia burgdorferi] 32 5.8 gi|436320|emb|CAA49309.1| p93 [Borrelia burgdorferi] 32 5.8 gi|540929|pir||S40308 p100 protein - Lyme disease spirochet... 32 5.8 gi|8394429|ref|NP_058876.1| T-cell death associated gene [R... 31 7.6 gi|25140993|ref|NP_705938.1| pleiomorphic adenoma gene-like... 31 7.6 gi|20807169|ref|NP_622340.1| Methyl-accepting chemotaxis pr... 31 7.6 gi|6678269|ref|NP_033370.1| pleckstrin homology-like domain... 31 7.6 gi|18310846|ref|NP_562780.1| hypothetical protein [Clostrid... 31 7.6 gi|17569047|ref|NP_509136.1| Yeast Mitosis Arrest DeFicient... 31 7.6 gi|16804026|ref|NP_465511.1| similar to 2-isopropylmalate s... 31 7.6 gi|1706291|sp|P54682|D7_DICDI CAMP-INDUCIBLE PRESPORE PROTE... 31 7.6 gi|23485570|gb|EAA20475.1| 235 kDa rhoptry protein [Plasmod... 31 7.6 gi|20481618|ref|XP_118485.1| hypothetical protein XP_118485... 31 7.6 gi|18203969|gb|AAH21315.1| Similar to hypothetical protein ... 31 10.0 gi|9246934|gb|AAF86208.1| VrrB [Bacillus anthracis] 31 10.0 gi|21287734|gb|EAA00055.1| agCP9352 [Anopheles gambiae str.... 31 10.0 gi|17137166|ref|NP_477144.1| CG10379-PA [Drosophila melanog... 31 10.0 gi|14521300|ref|NP_126775.1| hypothetical protein [Pyrococc... 31 10.0 gi|6981040|ref|NP_037207.1| homeobox A1 protein [Rattus nor... 31 10.0 gi|21294035|gb|EAA06180.1| agCP13478 [Anopheles gambiae str... 31 10.0 gi|3851331|emb|CAA70484.1| putative MADS-domain transcripti... 31 10.0 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|15226027|ref|NP_179097.1| unknown protein; protein id: A... 218 3e-56 gi|6648962|gb|AAF21309.1| seed maturation protein PM23 [Gly... 192 3e-48 gi|21536629|gb|AAM60961.1| seed maturation-like protein [Ar... 99 3e-20 gi|15242177|ref|NP_197001.1| seed maturation -like protein;... 99 3e-20 gi|17231303|ref|NP_487851.1| hypothetical protein [Nostoc s... 43 0.003 gi|15222486|ref|NP_176549.1| unknown protein; protein id: A... 42 0.004 gi|25404427|pir||B96661 unknown protein, 83181-85105 [impor... 42 0.004 gi|23043765|gb|ZP_00075004.1| hypothetical protein [Trichod... 40 0.021 gi|17232657|ref|NP_489205.1| hypothetical protein [Nostoc s... 40 0.021 gi|581306|emb|CAA53070.1| histidin kinase [Lactobacillus pl... 38 0.062 gi|16331041|ref|NP_441769.1| unknown protein [Synechocystis... 38 0.062 gi|23127708|gb|ZP_00109571.1| hypothetical protein [Nostoc ... 38 0.081 gi|23133544|gb|ZP_00115318.1| hypothetical protein [Synecho... 37 0.14 gi|23122461|gb|ZP_00104596.1| hypothetical protein [Prochlo... 37 0.14 gi|23613288|ref|NP_703610.1| hypothetical protein [Plasmodi... 37 0.18 gi|22299567|ref|NP_682814.1| ORF_ID:tll2024~hypothetical pr... 35 0.40 gi|16330948|ref|NP_441676.1| hypothetical protein [Synechoc... 35 0.40 gi|24414838|emb|CAD55651.1| hypothetical protein [Synechoco... 35 0.69 gi|23101971|gb|ZP_00088507.1| hypothetical protein [Azotoba... 35 0.69 gi|20090774|ref|NP_616849.1| conserved hypothetical protein... 35 0.69 gi|15668751|ref|NP_247550.1| aspartate kinase (lysC) [Metha... 34 0.90 gi|3766232|gb|AAC64407.1| kinectin [Vulpes vulpes] 34 0.90 gi|5869760|emb|CAA49829.1| p93 [Borrelia burgdorferi] 34 0.90 gi|23509492|ref|NP_702159.1| ribosomal protein L15, putativ... 34 0.90 gi|23478398|gb|EAA15496.1| hypothetical protein [Plasmodium... 34 1.2 gi|17230579|ref|NP_487127.1| hypothetical protein [Nostoc s... 34 1.2 gi|559543|gb|AAB58346.1| p93 antigen 33 1.5 gi|2120490|pir||S61463 p83/100 protein - Lyme disease spiro... 33 1.5 gi|2120487|pir||S61464 p83/100 protein - Lyme disease spiro... 33 1.5 gi|853736|emb|CAA54797.1| P97 protein [Borrelia burgdorferi] 33 1.5 gi|2120492|pir||I40090 p93 protein - Lyme disease spirochet... 33 1.5 gi|346275|pir||A45033 myelin transcription factor 1 - human... 33 1.5 gi|1272517|emb|CAA57125.1| p83/100 [Borrelia burgdorferi] 33 1.5 gi|7463732|pir||S61460 p83/100 protein - Lyme disease spiro... 33 1.5 gi|15595089|ref|NP_212878.1| antigen, p83/100 [Borrelia bur... 33 1.5 gi|5689437|dbj|BAA83002.1| KIAA1050 protein [Homo sapiens] 33 2.0 gi|1076739|pir||S53306 MADS box protein MADS1 - rice >gi|50... 33 2.0 gi|16078573|ref|NP_389392.1| similar to hypothetical protei... 33 2.0 gi|17975763|ref|NP_004526.1| myelin transcription factor 1;... 33 2.0 gi|9246936|gb|AAF86209.1| VrrB [Bacillus anthracis] 33 2.6 gi|9246917|gb|AAF86199.1|AF238885_2 VrrB [Bacillus anthracis] 33 2.6 gi|23482118|gb|EAA18193.1| hypothetical protein [Plasmodium... 33 2.6 gi|2147891|pir||S61461 p83/100 protein - Borrelia garinii (... 33 2.6 gi|7512169|pir||T14156 kinesin-related protein - African cl... 33 2.6 gi|9246944|gb|AAF86213.1| VrrB [Bacillus anthracis] 33 2.6 gi|9246946|gb|AAF86214.1| VrrB [Bacillus anthracis] 33 2.6 gi|20349232|ref|XP_111984.1| similar to RIKEN cDNA C330016H... 33 2.6 gi|9246930|gb|AAF86206.1| VrrB [Bacillus anthracis] 33 2.6 gi|9246926|gb|AAF86204.1| VrrB [Bacillus anthracis] 33 2.6 gi|15054439|gb|AAK77948.1| M protein [Streptococcus pyogenes] 32 3.4 gi|7959339|dbj|BAA96060.1| KIAA1536 protein [Homo sapiens] 32 3.4 gi|20094860|ref|NP_614707.1| Valyl-tRNA synthetase [Methano... 32 3.4 gi|23123455|gb|ZP_00105590.1| hypothetical protein [Prochlo... 32 3.4 gi|24647540|ref|NP_524896.2| CG11648-PB [Drosophila melanog... 32 3.4 gi|2120494|pir||I40141 p93 protein - Lyme disease spirochet... 32 3.4 gi|226723|prf||1604246A Abdominal-B gene 32 3.4 gi|321026|pir||A34220 homeotic protein Abd-B - fruit fly (D... 32 3.4 gi|14042878|dbj|BAB55428.1| unnamed protein product [Homo s... 32 3.4 gi|2120489|pir||S61462 p83/100 protein - Lyme disease spiro... 32 3.4 gi|17647993|ref|NP_524080.1| CG18492-PA [Drosophila melanog... 32 3.4 gi|6942201|gb|AAF32355.1|AF220353_1 kinesin-like kinetochor... 32 3.4 gi|24583666|ref|NP_524993.2| CG6392-PA [Drosophila melanoga... 32 3.4 gi|14149742|ref|NP_065949.1| KIAA1536 protein [Homo sapiens... 32 3.4 gi|1711385|sp|P54214|SFAS_DUNBI SF-assemblin >gi|1279362|em... 32 4.5 gi|26006217|dbj|BAC41451.1| mKIAA0835 protein [Mus musculus] 32 4.5 gi|23346429|ref|NP_032691.2| myelin transcription factor 1;... 32 4.5 gi|15149491|ref|NP_150373.1| E2F transcription factor 6 [Mu... 32 5.8 gi|17352153|gb|AAL38216.1|AF393249_1 E2F6a [Mus musculus] 32 5.8 gi|21306289|gb|AAM45941.1|AF487711_1 transcriptional repres... 32 5.8 gi|24943010|gb|AAM98022.2| Hypothetical protein F35D11.11d ... 32 5.8 gi|17533741|ref|NP_494820.1| M protein repeat containing pr... 32 5.8 gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanog... 32 5.8 gi|20151561|gb|AAM11140.1| LD14856p [Drosophila melanogaster] 32 5.8 gi|21241330|ref|NP_640912.1| conserved hypothetical protein... 32 5.8 gi|17533739|ref|NP_494819.1| M protein repeat containing pr... 32 5.8 gi|17533743|ref|NP_494821.1| M protein repeat containing pr... 32 5.8 gi|18391490|ref|NP_563924.1| putative nuclear matrix consti... 32 5.8 gi|24666890|ref|NP_649137.2| CG8789-PA [Drosophila melanoga... 32 5.8 gi|17352154|gb|AAL38217.1|AF393249_2 E2F6b [Mus musculus] >... 32 5.8 gi|436324|emb|CAA49311.1| p93 [Borrelia burgdorferi] 32 5.8 gi|436320|emb|CAA49309.1| p93 [Borrelia burgdorferi] 32 5.8 gi|540929|pir||S40308 p100 protein - Lyme disease spirochet... 32 5.8 gi|8394429|ref|NP_058876.1| T-cell death associated gene [R... 31 7.6 gi|25140993|ref|NP_705938.1| pleiomorphic adenoma gene-like... 31 7.6 gi|20807169|ref|NP_622340.1| Methyl-accepting chemotaxis pr... 31 7.6 gi|6678269|ref|NP_033370.1| pleckstrin homology-like domain... 31 7.6 gi|18310846|ref|NP_562780.1| hypothetical protein [Clostrid... 31 7.6 gi|17569047|ref|NP_509136.1| Yeast Mitosis Arrest DeFicient... 31 7.6 gi|16804026|ref|NP_465511.1| similar to 2-isopropylmalate s... 31 7.6 gi|1706291|sp|P54682|D7_DICDI CAMP-INDUCIBLE PRESPORE PROTE... 31 7.6 gi|23485570|gb|EAA20475.1| 235 kDa rhoptry protein [Plasmod... 31 7.6 gi|20481618|ref|XP_118485.1| hypothetical protein XP_118485... 31 7.6 gi|18203969|gb|AAH21315.1| Similar to hypothetical protein ... 31 10.0 gi|9246934|gb|AAF86208.1| VrrB [Bacillus anthracis] 31 10.0 gi|21287734|gb|EAA00055.1| agCP9352 [Anopheles gambiae str.... 31 10.0 gi|17137166|ref|NP_477144.1| CG10379-PA [Drosophila melanog... 31 10.0 gi|14521300|ref|NP_126775.1| hypothetical protein [Pyrococc... 31 10.0 gi|6981040|ref|NP_037207.1| homeobox A1 protein [Rattus nor... 31 10.0 gi|21294035|gb|EAA06180.1| agCP13478 [Anopheles gambiae str... 31 10.0 gi|3851331|emb|CAA70484.1| putative MADS-domain transcripti... 31 10.0
>gi|15226027|ref|NP_179097.1| unknown protein; protein id: At2g14910.1, supported by cDNA: gi_17380883, supported by cDNA: gi_19698842, supported by cDNA: gi_20465934 [Arabidopsis thaliana] gi|25368604|pir||H84522 hypothetical protein At2g14910 [imported] - Arabidopsis thaliana gi|3650033|gb|AAC61288.1| unknown protein [Arabidopsis thaliana] gi|17380884|gb|AAL36254.1| unknown protein [Arabidopsis thaliana] gi|19698843|gb|AAL91157.1| unknown protein [Arabidopsis thaliana] gi|20465935|gb|AAM20153.1| unknown protein [Arabidopsis thaliana] Length = 386 Score = 218 bits (555), Expect = 3e-56 Identities = 111/162 (68%), Positives = 129/162 (79%), Gaps = 4/162 (2%) Frame = +1 Query: 73 EDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTP 252 E LG ++ + ++YI++LQSQL ++KKEL ++RRKN+ALQMQQFVGEEKNDLLDYLRSL P Sbjct: 209 EGLGRVSSEAQEYILRLQSQLSSVKKELQEMRRKNAALQMQQFVGEEKNDLLDYLRSLQP 268 Query: 253 EKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAP----PPXXXXXXXXXXXXXEDD 420 EKVAELSE +P V+E IHSVVHGLLATLSPK+HSK P PP D+ Sbjct: 269 EKVAELSEPAAPEVKETIHSVVHGLLATLSPKMHSKFPASEVPP------TETVKAKSDE 322 Query: 421 DCAELVENASLPFQPLISVPRDYLARLLFWCMLLGHYIRGLE 546 DCAELVEN SL FQPLIS+ RDYLARLLFWCMLLGHY+RGLE Sbjct: 323 DCAELVENTSLQFQPLISLTRDYLARLLFWCMLLGHYLRGLE 364
>gi|6648962|gb|AAF21309.1| seed maturation protein PM23 [Glycine max] Length = 404 Score = 192 bits (487), Expect = 3e-48 Identities = 96/173 (55%), Positives = 127/173 (73%) Frame = +1 Query: 25 KTLKKMMKNYHVKLVGEDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFV 204 K L ++ H ++ ++LG ++ + + YI LQS+L +MKKELH+++RK++ALQMQQFV Sbjct: 207 KNLSSKVEKLHEEVDIQELGEISAEAQQYIFNLQSRLSSMKKELHEVKRKSAALQMQQFV 266 Query: 205 GEEKNDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPXXXX 384 GEEKNDLLDYLRSL PE+VA+LSE TSP +++ I SVVHGLLATLSPK+HSK P Sbjct: 267 GEEKNDLLDYLRSLQPEQVAQLSEFTSPELKDTILSVVHGLLATLSPKMHSK--PSTMSE 324 Query: 385 XXXXXXXXXEDDDCAELVENASLPFQPLISVPRDYLARLLFWCMLLGHYIRGL 543 +DCAE++EN++L FQP+IS+ RDYLARLLFWCML + GL Sbjct: 325 NTTVGATNAGSEDCAEVLENSALQFQPVISLTRDYLARLLFWCMLWDTILEGL 377
>gi|21536629|gb|AAM60961.1| seed maturation-like protein [Arabidopsis thaliana] Length = 355 Score = 99.0 bits (245), Expect = 3e-20 Identities = 60/169 (35%), Positives = 90/169 (53%), Gaps = 7/169 (4%) Frame = +1 Query: 61 KLVGEDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLR 240 +L + G+L+P+ YI LQS+L +MK+EL ++K ++ ++ +NDLLDYLR Sbjct: 201 RLSPQVFGDLSPEALSYIQLLQSELSSMKEELDSQKKKALRIECEK---GNRNDLLDYLR 257 Query: 241 SLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPXXXXXXXXXXXXXEDD 420 SL PE V ELS+ +SP V+E ++ +V +L L ED Sbjct: 258 SLDPEMVTELSQLSSPEVEEIVNQLVQNVLERL-----------------------FEDQ 294 Query: 421 DCAELVENASLPFQP-------LISVPRDYLARLLFWCMLLGHYIRGLE 546 + ++N + + RDYLA+LLFWCMLLGH++RGLE Sbjct: 295 TTSNFMQNPGIRTTDGGDGTGRKVDTSRDYLAKLLFWCMLLGHHLRGLE 343
>gi|15242177|ref|NP_197001.1| seed maturation -like protein; protein id: At5g14970.1, supported by cDNA: 106301. [Arabidopsis thaliana] gi|11346180|pir||T51442 seed maturation-like protein - Arabidopsis thaliana gi|9755664|emb|CAC01816.1| seed maturation-like protein [Arabidopsis thaliana] gi|22655278|gb|AAM98229.1| seed maturation-like protein [Arabidopsis thaliana] Length = 355 Score = 99.0 bits (245), Expect = 3e-20 Identities = 60/169 (35%), Positives = 90/169 (53%), Gaps = 7/169 (4%) Frame = +1 Query: 61 KLVGEDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLR 240 +L + G+L+P+ YI LQS+L +MK+EL ++K ++ ++ +NDLLDYLR Sbjct: 201 RLSPQVFGDLSPEALSYIQLLQSELSSMKEELDSQKKKALRIECEK---GNRNDLLDYLR 257 Query: 241 SLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPXXXXXXXXXXXXXEDD 420 SL PE V ELS+ +SP V+E ++ +V +L L ED Sbjct: 258 SLDPEMVTELSQLSSPEVEEIVNQLVQNVLERL-----------------------FEDQ 294 Query: 421 DCAELVENASLPFQP-------LISVPRDYLARLLFWCMLLGHYIRGLE 546 + ++N + + RDYLA+LLFWCMLLGH++RGLE Sbjct: 295 TTSNFMQNPGIRTTEGGDGTGRKVDTSRDYLAKLLFWCMLLGHHLRGLE 343
>gi|17231303|ref|NP_487851.1| hypothetical protein [Nostoc sp. PCC 7120] gi|25531703|pir||AD2282 hypothetical protein alr3811 [imported] - Nostoc sp. (strain PCC 7120) gi|8489798|gb|AAF75756.1|AF262216_3 unknown [Nostoc sp. PCC 7120] gi|17132945|dbj|BAB75510.1| ORF_ID:alr3811~hypothetical protein [Nostoc sp. PCC 7120] Length = 157 Score = 42.7 bits (99), Expect = 0.003 Identities = 36/146 (24%), Positives = 57/146 (39%) Frame = +1 Query: 109 YIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELSESTSP 288 Y+ L S + +E + N + E N L Y++SL+PE V +LS+ TSP Sbjct: 27 YLKPLSSHPPVLLQEEKVSNQSNRVSEFFNSDSETANLLWQYVKSLSPETVTQLSKPTSP 86 Query: 289 GVQEAIHSVVHGLLATLSPKIHSKAPPPXXXXXXXXXXXXXEDDDCAELVENASLPFQPL 468 V + + + GLL L P+ F Sbjct: 87 EVFQVMERNIIGLLGNLPPE-----------------------------------HFGVT 111 Query: 469 ISVPRDYLARLLFWCMLLGHYIRGLE 546 I+ R++L RLL M+ G+++R E Sbjct: 112 ITTSREHLGRLLASAMISGYFLRNAE 137
>gi|15222486|ref|NP_176549.1| unknown protein; protein id: At1g63610.1 [Arabidopsis thaliana] Length = 334 Score = 42.0 bits (97), Expect = 0.004 Identities = 32/144 (22%), Positives = 63/144 (43%) Frame = +1 Query: 115 IQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELSESTSPGV 294 I + ++ ++ E+ +L R Q+ + ++N++L+YL+SL P+ + EL+ + V Sbjct: 206 IDAKKYIELLEAEIEELNR-----QVGRKSANQQNEILEYLKSLEPQNLKELTSTAGEDV 260 Query: 295 QEAIHSVVHGLLATLSPKIHSKAPPPXXXXXXXXXXXXXEDDDCAELVENASLPFQPLIS 474 A+++ V LLA P ++ N + Sbjct: 261 AVAMNTFVKRLLAVSDPN---------------------------QMKTNVT-------E 286 Query: 475 VPRDYLARLLFWCMLLGHYIRGLE 546 LA+LL+W M++G+ IR +E Sbjct: 287 TSAADLAKLLYWLMVVGYSIRNIE 310
>gi|25404427|pir||B96661 unknown protein, 83181-85105 [imported] - Arabidopsis thaliana gi|12324944|gb|AAG52423.1|AC011622_11 unknown protein; 83181-85105 [Arabidopsis thaliana] Length = 340 Score = 42.0 bits (97), Expect = 0.004 Identities = 32/144 (22%), Positives = 63/144 (43%) Frame = +1 Query: 115 IQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELSESTSPGV 294 I + ++ ++ E+ +L R Q+ + ++N++L+YL+SL P+ + EL+ + V Sbjct: 212 IDAKKYIELLEAEIEELNR-----QVGRKSANQQNEILEYLKSLEPQNLKELTSTAGEDV 266 Query: 295 QEAIHSVVHGLLATLSPKIHSKAPPPXXXXXXXXXXXXXEDDDCAELVENASLPFQPLIS 474 A+++ V LLA P ++ N + Sbjct: 267 AVAMNTFVKRLLAVSDPN---------------------------QMKTNVT-------E 292 Query: 475 VPRDYLARLLFWCMLLGHYIRGLE 546 LA+LL+W M++G+ IR +E Sbjct: 293 TSAADLAKLLYWLMVVGYSIRNIE 316
>gi|23043765|gb|ZP_00075004.1| hypothetical protein [Trichodesmium erythraeum IMS101] Length = 583 Score = 39.7 bits (91), Expect = 0.021 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 18/114 (15%) Frame = +1 Query: 58 VKLVGEDLGN----LTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKND- 222 +KLV +DL N LT Q+ + +L+++ + + ++++ LR++ LQ+QQ + Sbjct: 24 LKLVIQDLDNFRQDLTHQLGQDVSRLRAEKEQLNEDVNKLRKQYEQLQVQQLESLSQRQI 83 Query: 223 -------------LLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSP 345 L + L+ K+ EL ES PG+Q+ + S GL T SP Sbjct: 84 AQQQLWLKQLAQVLANNLQKQLGHKIKELKESVDPGLQQGVSS-GGGLPMTNSP 136
>gi|17232657|ref|NP_489205.1| hypothetical protein [Nostoc sp. PCC 7120] gi|25308194|pir||AE2451 hypothetical protein all5165 [imported] - Nostoc sp. (strain PCC 7120) gi|17134303|dbj|BAB76864.1| ORF_ID:all5165~hypothetical protein [Nostoc sp. PCC 7120] Length = 114 Score = 39.7 bits (91), Expect = 0.021 Identities = 20/62 (32%), Positives = 35/62 (56%) Frame = +1 Query: 154 LHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLA 333 L+D +++ + GE N LL YL+ +PE +A +++S SP +++ I V GL+ Sbjct: 8 LNDNSEEHTNQILSDHFGEHPNQLLKYLQHQSPEVLARVAQSVSPEIKQIISQNVQGLVG 67 Query: 334 TL 339 L Sbjct: 68 ML 69
>gi|581306|emb|CAA53070.1| histidin kinase [Lactobacillus plantarum] gi|1495670|emb|CAA64205.1| histidine protein kinase PlnB [Lactobacillus plantarum] Length = 442 Score = 38.1 bits (87), Expect = 0.062 Identities = 26/90 (28%), Positives = 46/90 (51%) Frame = +1 Query: 61 KLVGEDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLR 240 K+ E L N Q+ DY+ ++ Q ++K HD + ++L Q + E K+ L DY + Sbjct: 224 KIAAEKLQN--KQLNDYLKSVEHQYLELRKFKHDYKNLIASLNTQDNISEIKDYLTDYTQ 281 Query: 241 SLTPEKVAELSESTSPGVQEAIHSVVHGLL 330 S E A L++ + VQ + ++ GL+ Sbjct: 282 S--GEFRASLNDGSIASVQHLKNEILRGLV 309
>gi|16331041|ref|NP_441769.1| unknown protein [Synechocystis sp. PCC 6803] gi|7446611|pir||S76190 hypothetical protein - Synechocystis sp. (strain PCC 6803) gi|1653536|dbj|BAA18449.1| ORF_ID:slr1638~unknown protein [Synechocystis sp. PCC 6803] Length = 107 Score = 38.1 bits (87), Expect = 0.062 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = +1 Query: 217 NDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATL 339 N LL YL+ PE +A +++S SP ++E IH V GL+ L Sbjct: 18 NTLLQYLQKQHPETLAWIAQSASPEIKEIIHQNVQGLVGML 58
>gi|23127708|gb|ZP_00109571.1| hypothetical protein [Nostoc punctiforme] Length = 114 Score = 37.7 bits (86), Expect = 0.081 Identities = 33/113 (29%), Positives = 47/113 (41%), Gaps = 1/113 (0%) Frame = +1 Query: 211 EKNDLL-DYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPXXXXX 387 E NDLL Y++SL+PE V +LS+ TS V + + + GLL L P H Sbjct: 17 ETNDLLWQYVKSLSPETVTQLSKPTSAEVFQVMERNITGLLGNL-PSEH----------- 64 Query: 388 XXXXXXXXEDDDCAELVENASLPFQPLISVPRDYLARLLFWCMLLGHYIRGLE 546 F +S R+ L RLL M+ G+++R E Sbjct: 65 -----------------------FGITVSTSRESLGRLLASAMISGYFLRNAE 94
>gi|23133544|gb|ZP_00115318.1| hypothetical protein [Synechococcus sp. WH 8102] Length = 117 Score = 37.0 bits (84), Expect = 0.14 Identities = 28/114 (24%), Positives = 47/114 (41%) Frame = +1 Query: 205 GEEKNDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPXXXX 384 G+ N L+ YL+ TP+ + +++S S +Q+ I V GLL L P H Sbjct: 14 GQAGNSLIQYLQEQTPDTLQRVAKSASNDIQDIIRHNVQGLLGML-PGEH---------- 62 Query: 385 XXXXXXXXXEDDDCAELVENASLPFQPLISVPRDYLARLLFWCMLLGHYIRGLE 546 F+ ++ RD LA +L M+ G+++R +E Sbjct: 63 ------------------------FEVKVTANRDNLANMLASAMMTGYFLRQME 92
>gi|23122461|gb|ZP_00104596.1| hypothetical protein [Prochlorococcus marinus subsp. pastoris str. CCMP1378] Length = 112 Score = 37.0 bits (84), Expect = 0.14 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +1 Query: 211 EKNDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATL 339 ++NDL+ YL+ +PE + +++S S +QE I V GLL L Sbjct: 16 DENDLIQYLQKQSPEVMQRVAKSASEDIQEIIRHNVQGLLGML 58
>gi|23613288|ref|NP_703610.1| hypothetical protein [Plasmodium falciparum 3D7] gi|23504849|emb|CAD51630.1| hypothetical protein [Plasmodium falciparum 3D7] Length = 796 Score = 36.6 bits (83), Expect = 0.18 Identities = 30/148 (20%), Positives = 68/148 (45%) Frame = +1 Query: 103 EDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELSEST 282 ++YI+ L+ ++++++K+L+ L+ + L +DLL Y++SLT ++ L+++ Sbjct: 677 KNYILFLRKKINSLEKQLNILKESKTFLN---------DDLLSYIKSLTEIQLRSLTDNI 727 Query: 283 SPGVQEAIHSVVHGLLATLSPKIHSKAPPPXXXXXXXXXXXXXEDDDCAELVENASLPFQ 462 P V ++ +V ++ ++ I+ +N S Sbjct: 728 GPLVLDSTKKIVELVIQGMTLNIN----------------------------KNMS---N 756 Query: 463 PLISVPRDYLARLLFWCMLLGHYIRGLE 546 LI V L + FW +++G+ +R +E Sbjct: 757 ELIYVSGSVLTYICFWQLIIGYTLREME 784
>gi|22299567|ref|NP_682814.1| ORF_ID:tll2024~hypothetical protein [Thermosynechococcus elongatus BP-1] gi|22295751|dbj|BAC09576.1| ORF_ID:tll2024~hypothetical protein [Thermosynechococcus elongatus BP-1] Length = 110 Score = 35.4 bits (80), Expect = 0.40 Identities = 29/112 (25%), Positives = 45/112 (40%) Frame = +1 Query: 211 EKNDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPXXXXXX 390 + N LL YL+S +PE + ++ S SP +++ I V GL+ L Sbjct: 19 QPNLLLKYLQSQSPEVLTRIARSVSPEIRQIISQNVQGLVGGL----------------- 61 Query: 391 XXXXXXXEDDDCAELVENASLPFQPLISVPRDYLARLLFWCMLLGHYIRGLE 546 S F I+ RD LA LL M+ G+++R +E Sbjct: 62 ------------------PSEDFNVQIATDRDNLAGLLASAMMTGYFLRQME 95
>gi|16330948|ref|NP_441676.1| hypothetical protein [Synechocystis sp. PCC 6803] gi|7446610|pir||S75897 hypothetical protein slr1674 - Synechocystis sp. (strain PCC 6803) gi|1653442|dbj|BAA18356.1| ORF_ID:slr1674~hypothetical protein [Synechocystis sp. PCC 6803] Length = 116 Score = 35.4 bits (80), Expect = 0.40 Identities = 31/119 (26%), Positives = 46/119 (38%), Gaps = 3/119 (2%) Frame = +1 Query: 199 FVGEE---KNDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPP 369 F G E K+ L Y++ L+PE +A+LS S V + + + GLL L P+ Sbjct: 12 FAGNEAPGKDSLWTYVQELSPETIAQLSRPDSQEVFQVMERNIIGLLGNLPPE------- 64 Query: 370 PXXXXXXXXXXXXXEDDDCAELVENASLPFQPLISVPRDYLARLLFWCMLLGHYIRGLE 546 F IS R+ L RLL M+ G+++R E Sbjct: 65 ----------------------------HFGVTISTSRENLGRLLASAMMSGYFLRNAE 95
>gi|24414838|emb|CAD55651.1| hypothetical protein [Synechococcus sp. PCC 7942] Length = 125 Score = 34.7 bits (78), Expect = 0.69 Identities = 29/110 (26%), Positives = 44/110 (40%) Frame = +1 Query: 217 NDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPXXXXXXXX 396 N LL YL+ +PE +A +++S + +QE I V GLL L Sbjct: 18 NALLQYLQHQSPEVMARVAKSATSDIQEIIQQNVQGLLGML------------------- 58 Query: 397 XXXXXEDDDCAELVENASLPFQPLISVPRDYLARLLFWCMLLGHYIRGLE 546 S F I+ R+ LA LL M+ G+++R +E Sbjct: 59 ----------------PSEGFNVQIATSRENLAGLLASAMMTGYFLRQME 92
>gi|23101971|gb|ZP_00088507.1| hypothetical protein [Azotobacter vinelandii] Length = 1101 Score = 34.7 bits (78), Expect = 0.69 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 20/118 (16%) Frame = +1 Query: 28 TLKKMMKNYHVKLVGEDLGNLTPQVEDYIIQLQSQLDAMKKEL-----HDLRRKNSALQM 192 T +++ K Y L EDLG++ + +LQ QL ++ ++L +R + AL++ Sbjct: 748 TQRELAKEYFPTLAPEDLGDIIELERKHTRELQQQLKSLSEKLSYQQAELAKRMSDALKV 807 Query: 193 Q----QFVGEEKNDL---LDYLRSLTPEKVAE--------LSESTSPGVQEAIHSVVH 321 VG E D+ L+ LR LT E + E L+ S+ GV + + + H Sbjct: 808 DTGALSEVGRELADIPKYLERLRVLTEEALPEKLKRFLEYLNRSSDDGVTQLLSYIDH 865
>gi|20090774|ref|NP_616849.1| conserved hypothetical protein [Methanosarcina acetivorans str. C2A] gi|19915835|gb|AAM05329.1| conserved hypothetical protein [Methanosarcina acetivorans str. C2A] Length = 190 Score = 34.7 bits (78), Expect = 0.69 Identities = 27/109 (24%), Positives = 48/109 (44%), Gaps = 12/109 (11%) Frame = +1 Query: 34 KKMMKNYHVKLVGEDLGNLTPQV-------EDYII-----QLQSQLDAMKKELHDLRRKN 177 K K Y +KL + +TPQ+ E+Y +Q +D LH+ N Sbjct: 3 KTFEKVYQLKL---SMKGITPQIWRRIQVPENYTFLDLHDAIQDVMDWEDYHLHEFEMPN 59 Query: 178 SALQMQQFVGEEKNDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHG 324 + +G E +D ++ L PEK A++S +P ++A+++ G Sbjct: 60 PKTGVLDKIGTEGDDFEAFVEPLVPEKKAKISNYFTPENKDALYTYDFG 108
>gi|15668751|ref|NP_247550.1| aspartate kinase (lysC) [Methanococcus jannaschii] gi|2492982|sp|Q57991|AK_METJA Probable aspartokinase (Aspartate kinase) gi|2127773|pir||C64371 aspartate kinase (EC 2.7.2.4) I - Methanococcus jannaschii gi|1591278|gb|AAB98565.1| aspartate kinase (lysC) [Methanococcus jannaschii] Length = 473 Score = 34.3 bits (77), Expect = 0.90 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Frame = +1 Query: 79 LGNLTPQVEDYIIQLQSQLDA--MKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTP 252 LG LTP+ DYI+ +L + + + DL K+ AL+ G E + D Sbjct: 114 LGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALE-----GGEAGIITDNNFGSAR 168 Query: 253 EKVAELSESTSPGVQEAIHSVVHGLLAT 336 K E+ E P ++E I VV G + T Sbjct: 169 VKRLEVKERLLPLLKEGIIPVVTGFIGT 196
>gi|3766232|gb|AAC64407.1| kinectin [Vulpes vulpes] Length = 1330 Score = 34.3 bits (77), Expect = 0.90 Identities = 27/99 (27%), Positives = 48/99 (48%) Frame = +1 Query: 73 EDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTP 252 E+L + + E I LQ++LD++K+ + R+KN+ L+ + + E + L + Sbjct: 995 EELLKVISEREKEITGLQNELDSLKEAVEHQRKKNNDLREKNW---EAMEALASTEKMLQ 1051 Query: 253 EKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAPP 369 +KV + S+ EAI +L L PK+ PP Sbjct: 1052 DKVNKTSKVERQQYVEAIELEAKEVLKKLFPKV--SVPP 1088
>gi|5869760|emb|CAA49829.1| p93 [Borrelia burgdorferi] Length = 708 Score = 34.3 bits (77), Expect = 0.90 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KKE +L +K L Q + D LD Sbjct: 258 ITETIENLRDQLEKATDEEHKKEIESQVDAKKKEKEELDKKAINLDKAQQKLDSAEDNLD 317 Query: 232 YLRSLTPEKVAE 267 R EK+ E Sbjct: 318 VQRDTVREKIQE 329
>gi|23509492|ref|NP_702159.1| ribosomal protein L15, putative [Plasmodium falciparum 3D7] gi|23497338|gb|AAN36883.1|AE014820_33 ribosomal protein L15, putative [Plasmodium falciparum 3D7] Length = 545 Score = 34.3 bits (77), Expect = 0.90 Identities = 25/92 (27%), Positives = 50/92 (54%), Gaps = 4/92 (4%) Frame = +1 Query: 10 KKICCKTLKKMMKNYHVKLVGEDLGNLT---PQVEDYIIQLQSQLDAMKKELHDLRRKNS 180 K++ K LK ++ +K + E++ N T P E+ LQ+ + M++ + + ++ Sbjct: 155 KRLISKKLK--LRREQLKKIEEEINNGTYKSPYNEEQREFLQNVIKEMEQAIEPINKEIE 212 Query: 181 ALQMQQF-VGEEKNDLLDYLRSLTPEKVAELS 273 ++ +F V +EKNDLL LR +K+ E++ Sbjct: 213 QIEKNRFLVFDEKNDLLVKLREQIEKKIDEVN 244
>gi|23478398|gb|EAA15496.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 662 Score = 33.9 bits (76), Expect = 1.2 Identities = 18/88 (20%), Positives = 47/88 (53%) Frame = +1 Query: 103 EDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELSEST 282 ++YII L+ ++++++ +L L+ + + +DLL Y++SLT ++ L+++ Sbjct: 543 KNYIIFLKKKINSLENQLKTLKENKTF---------QNDDLLSYIKSLTDIQLRSLTDNI 593 Query: 283 SPGVQEAIHSVVHGLLATLSPKIHSKAP 366 V +A +V ++ ++ ++ P Sbjct: 594 GAVVLDATKKIVELVIQGMTLNVNKNLP 621
>gi|17230579|ref|NP_487127.1| hypothetical protein [Nostoc sp. PCC 7120] gi|25534583|pir||AH2191 hypothetical protein all3087 [imported] - Nostoc sp. (strain PCC 7120) gi|17132181|dbj|BAB74786.1| ORF_ID:all3087~hypothetical protein [Nostoc sp. PCC 7120] Length = 542 Score = 33.9 bits (76), Expect = 1.2 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 5/77 (6%) Frame = +1 Query: 85 NLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDY-----LRSLT 249 NL Q+ D I Q +S +D +EL L R AL+ +Q G + +L+ L SLT Sbjct: 66 NLEQQIVDAISQAKSTIDVAVQELR-LPRIAQALKDKQKAGIKVRVILENTYTRSLSSLT 124 Query: 250 PEKVAELSESTSPGVQE 300 PE+V +L E QE Sbjct: 125 PEEVKKLPEREQARYQE 141
>gi|559543|gb|AAB58346.1| p93 antigen Length = 693 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K L Q + D LD Sbjct: 258 ITETIENLRDQLEKATDEEHRKEIESQVDAKKKQKEELDKKAIDLDKAQQKLDSSEDNLD 317 Query: 232 YLRSLTPEKVAE 267 R EK+ E Sbjct: 318 IQRDTVREKIQE 329
>gi|2120490|pir||S61463 p83/100 protein - Lyme disease spirochete (strain TN) gi|928989|emb|CAA53022.1| p100 protein [Borrelia burgdorferi] Length = 672 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K L Q + D LD Sbjct: 237 ITETIENLRDQLEKATDEEHRKEIESQVDAKKKQKEELDKKAIDLDKAQQKLDSSEDNLD 296 Query: 232 YLRSLTPEKVAE 267 R EK+ E Sbjct: 297 IQRDTVREKIQE 308
>gi|2120487|pir||S61464 p83/100 protein - Lyme disease spirochete (strain Goe2) Length = 693 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K L Q + D LD Sbjct: 258 ITETIENLRDQLEKATDEEHKKEIESQVDAKKKQKEELDKKAIDLDKAQQKLDSSEDNLD 317 Query: 232 YLRSLTPEKVAE 267 R EK+ E Sbjct: 318 IQRDTVREKIQE 329
>gi|853736|emb|CAA54797.1| P97 protein [Borrelia burgdorferi] Length = 693 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K L Q + D LD Sbjct: 258 ITETIENLRDQLEKATDEEHKKEIESQVDAKKKQKEELDKKAIDLDKAQQKLDSSEDNLD 317 Query: 232 YLRSLTPEKVAE 267 R EK+ E Sbjct: 318 IQRDTVREKIQE 329
>gi|2120492|pir||I40090 p93 protein - Lyme disease spirochete (fragment) gi|436322|emb|CAA49310.1| p93 [Borrelia burgdorferi] Length = 693 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K L Q + D LD Sbjct: 258 ITETIENLRDQLEKATDEEHRKEIESQVDAKKKQKEELDKKAIDLDKAQQKLDSSEDNLD 317 Query: 232 YLRSLTPEKVAE 267 R EK+ E Sbjct: 318 IQRDTVREKIQE 329
>gi|346275|pir||A45033 myelin transcription factor 1 - human (fragment) gi|189042|gb|AAA59897.1| myelin transcription factor 1 Length = 725 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/97 (22%), Positives = 45/97 (46%) Frame = +1 Query: 76 DLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPE 255 DL ++E ++QLQSQ+ +M+K L ++ +N ++ E+ L L L+ Sbjct: 617 DLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIE------EQNEALFLELSGLSQA 670 Query: 256 KVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAP 366 + L+ P ++ ++TL+ ++AP Sbjct: 671 LIQSLANIHLPHMEPICEQNFVPYVSTLTDMYSNQAP 707
>gi|1272517|emb|CAA57125.1| p83/100 [Borrelia burgdorferi] Length = 679 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K L Q + D LD Sbjct: 237 ITETIENLRDQLEKATDEEHKKEIESQVDAKKKQKEELDKKAINLDKAQQKLDSAEDNLD 296 Query: 232 YLRSLTPEKVAE 267 R+ EK+ E Sbjct: 297 VQRNTVREKIQE 308
>gi|7463732|pir||S61460 p83/100 protein - Lyme disease spirochete (strain PBre) Length = 679 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K L Q + D LD Sbjct: 237 ITETIENLRDQLEKATDEEHKKEIESQVDAKKKQKEELDKKAINLDKAQQKLDSAEDNLD 296 Query: 232 YLRSLTPEKVAE 267 R+ EK+ E Sbjct: 297 VQRNTVREKIQE 308
>gi|15595089|ref|NP_212878.1| antigen, p83/100 [Borrelia burgdorferi] gi|7463031|pir||G70192 antigen, p83/100 homolog - Lyme disease spirochete gi|2688679|gb|AAC67090.1| antigen, p83/100 [Borrelia burgdorferi] Length = 700 Score = 33.5 bits (75), Expect = 1.5 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K L Q + D LD Sbjct: 258 ITETIENLRDQLEKATDEEHKKEIESQVDAKKKQKEELDKKAINLDKAQQKLDSAEDNLD 317 Query: 232 YLRSLTPEKVAE 267 R+ EK+ E Sbjct: 318 VQRNTVREKIQE 329
>gi|5689437|dbj|BAA83002.1| KIAA1050 protein [Homo sapiens] Length = 829 Score = 33.1 bits (74), Expect = 2.0 Identities = 21/97 (21%), Positives = 44/97 (45%) Frame = +1 Query: 76 DLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPE 255 DL ++E ++QLQSQ+ +M+K L ++ +N ++ E+ L L L+ Sbjct: 721 DLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIE------EQNEALFLELSGLSQA 774 Query: 256 KVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAP 366 + L+ P ++ ++TL+ ++ P Sbjct: 775 LIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQDP 811
>gi|1076739|pir||S53306 MADS box protein MADS1 - rice gi|508577|gb|AAA66187.1| box protein gi|11493807|gb|AAG35652.1| MADS box protein MADS1 [Oryza sativa] Length = 257 Score = 33.1 bits (74), Expect = 2.0 Identities = 28/91 (30%), Positives = 46/91 (50%) Frame = +1 Query: 1 DYLKKICCKTLKKMMKNYHVKLVGEDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNS 180 +YLK KT + ++ ++GEDLG L+ + + QL++Q++ K++ RKN Sbjct: 91 EYLK---LKTRVEFLQTTQRNILGEDLGPLSMK---ELEQLENQIEVSLKQIRS--RKNQ 142 Query: 181 ALQMQQFVGEEKNDLLDYLRSLTPEKVAELS 273 AL Q F + K L L +K+ E S Sbjct: 143 ALLDQLFDLKSKEQQLQDLNKDLRKKLQETS 173
>gi|16078573|ref|NP_389392.1| similar to hypothetical proteins from B. subtilis [Bacillus subtilis] gi|8928491|sp|O34549|YLBO_BACSU Hypothetical protein ylbO gi|7429448|pir||D69875 conserved hypothetical protein ylbO - Bacillus subtilis gi|2340012|emb|CAB11362.1| YlbO protein [Bacillus subtilis] gi|2633880|emb|CAB13382.1| similar to hypothetical proteins from B. subtilis [Bacillus subtilis] Length = 193 Score = 33.1 bits (74), Expect = 2.0 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 7/63 (11%) Frame = +1 Query: 91 TPQVEDYIIQ---LQSQLDAMKKELHDLRRKNSALQMQQFVGEEKN----DLLDYLRSLT 249 TP +++ ++ L+ Q+ +++KEL DLR +N L+ Q + EE D++D R + Sbjct: 119 TPSAQEFQLEREKLKEQIQSLQKELEDLRSENQTLRNQLEMTEEDYKALIDIMDRARKMV 178 Query: 250 PEK 258 K Sbjct: 179 VSK 181
>gi|17975763|ref|NP_004526.1| myelin transcription factor 1; proteolipid protein binding protein [Homo sapiens] gi|13638422|sp|Q01538|MYT1_HUMAN Myelin transcription factor 1 (MYT1) (MYTI) (Proteolipid protein binding protein) (PLPB1) gi|4240159|dbj|BAA74858.1| KIAA0835 protein [Homo sapiens] gi|11323191|emb|CAC17005.1| dJ1022E24.3 (KIAA0835, similar to myelin transcription factor 1 (MYT1)) [Homo sapiens] Length = 1121 Score = 33.1 bits (74), Expect = 2.0 Identities = 21/97 (21%), Positives = 44/97 (45%) Frame = +1 Query: 76 DLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPE 255 DL ++E ++QLQSQ+ +M+K L ++ +N ++ E+ L L L+ Sbjct: 1013 DLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIE------EQNEALFLELSGLSQA 1066 Query: 256 KVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSKAP 366 + L+ P ++ ++TL+ ++ P Sbjct: 1067 LIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQDP 1103
>gi|9246936|gb|AAF86209.1| VrrB [Bacillus anthracis] Length = 118 Score = 32.7 bits (73), Expect = 2.6 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -1 Query: 493 QGNHGEQILGAEKVGMHSPQALHSHHPHPQDLVHPQKHY 377 QG+HG Q G H Q H HH H Q VH H+ Sbjct: 30 QGHHGHQ-------GHHHHQGHHGHHGHHQQQVHHHGHH 61
>gi|9246917|gb|AAF86199.1|AF238885_2 VrrB [Bacillus anthracis] Length = 265 Score = 32.7 bits (73), Expect = 2.6 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -1 Query: 493 QGNHGEQILGAEKVGMHSPQALHSHHPHPQDLVHPQKHY 377 QG+HG Q G H Q H HH H Q VH H+ Sbjct: 144 QGHHGHQ-------GHHHHQGHHGHHGHHQQQVHHHGHH 175
>gi|23482118|gb|EAA18193.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 294 Score = 32.7 bits (73), Expect = 2.6 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = +1 Query: 73 EDLGNLTPQVEDYIIQLQSQLDAMKKELHD 162 +DL N+ + + Y+++LQ +L+ +KKEL D Sbjct: 102 KDLNNVDKKTKKYVLKLQKELEGLKKELDD 131
>gi|2147891|pir||S61461 p83/100 protein - Borrelia garinii (strain PBr) gi|928999|emb|CAA58547.1| p83/100 [Borrelia garinii] Length = 666 Score = 32.7 bits (73), Expect = 2.6 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +1 Query: 67 VGEDLGNLTPQVE-----DYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVGEEKNDLLD 231 + E + NL Q+E ++ +++SQ+DA KK+ +L +K + Q + D LD Sbjct: 237 ITETIENLRDQLEKATDEEHRKEIESQVDAKKKQKEELDKKAIDIDKAQQKLDSSEDNLD 296 Query: 232 YLRSLTPEKVAE 267 R EK+ E Sbjct: 297 IQRDTVREKIQE 308
>gi|7512169|pir||T14156 kinesin-related protein - African clawed frog gi|2586071|gb|AAC60300.1| kinesin-related protein [Xenopus laevis] Length = 2954 Score = 32.7 bits (73), Expect = 2.6 Identities = 28/111 (25%), Positives = 54/111 (48%) Frame = +1 Query: 28 TLKKMMKNYHVKLVGEDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQFVG 207 +LK+ + ++L E L N +L ++D M+KE+ LR + Q ++ Sbjct: 2201 SLKEQLDQIQMELRNEKLRNY---------ELCEKMDIMEKEISVLRLMQNEPQQEEDDV 2251 Query: 208 EEKNDLLDYLRSLTPEKVAELSESTSPGVQEAIHSVVHGLLATLSPKIHSK 360 E+ D+L+ +++ EL E S A++S H LL++LS ++ + Sbjct: 2252 AERMDILESRN----QEIQELMEKIS-----AVYSEQHTLLSSLSSELQKE 2293
>gi|9246944|gb|AAF86213.1| VrrB [Bacillus anthracis] Length = 130 Score = 32.7 bits (73), Expect = 2.6 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -1 Query: 493 QGNHGEQILGAEKVGMHSPQALHSHHPHPQDLVHPQKHY 377 QG+HG Q G H Q H HH H Q VH H+ Sbjct: 42 QGHHGHQ-------GHHHHQGHHGHHGHHQQQVHHHGHH 73
>gi|9246946|gb|AAF86214.1| VrrB [Bacillus anthracis] Length = 133 Score = 32.7 bits (73), Expect = 2.6 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -1 Query: 493 QGNHGEQILGAEKVGMHSPQALHSHHPHPQDLVHPQKHY 377 QG+HG Q G H Q H HH H Q VH H+ Sbjct: 42 QGHHGHQ-------GHHHHQGHHGHHGHHQQQVHHHGHH 73
>gi|20349232|ref|XP_111984.1| similar to RIKEN cDNA C330016H24 [Mus musculus] Length = 384 Score = 32.7 bits (73), Expect = 2.6 Identities = 12/36 (33%), Positives = 27/36 (75%) Frame = +1 Query: 91 TPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQ 198 T + E+++++L+ +++ ++ +L +LRR+N ALQ Q Sbjct: 288 TVKAENHVLRLKQEINLLQAQLSNLRRENEALQSDQ 323
>gi|9246930|gb|AAF86206.1| VrrB [Bacillus anthracis] Length = 112 Score = 32.7 bits (73), Expect = 2.6 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -1 Query: 493 QGNHGEQILGAEKVGMHSPQALHSHHPHPQDLVHPQKHY 377 QG+HG Q G H Q H HH H Q VH H+ Sbjct: 30 QGHHGHQ-------GHHHHQGHHGHHGHHQQQVHHHGHH 61
>gi|9246926|gb|AAF86204.1| VrrB [Bacillus anthracis] Length = 109 Score = 32.7 bits (73), Expect = 2.6 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -1 Query: 493 QGNHGEQILGAEKVGMHSPQALHSHHPHPQDLVHPQKHY 377 QG+HG Q G H Q H HH H Q VH H+ Sbjct: 21 QGHHGHQ-------GHHHHQGHHGHHGHHQQQVHHHGHH 52
>gi|15054439|gb|AAK77948.1| M protein [Streptococcus pyogenes] Length = 240 Score = 32.3 bits (72), Expect = 3.4 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 3/75 (4%) Frame = +1 Query: 43 MKNYHVKLVG--EDLGNLTPQVEDYIIQLQSQLDAMKKELHDLRRKNSALQMQQF-VGEE 213 +KN + KL +DL + +++ QL ++ A+K+E ++ N ALQ Q + E Sbjct: 50 LKNTNGKLQSRNDDLTSENAELKQRSDQLSTEKQALKEEAEKTKQNNEALQTQNANLTSE 109 Query: 214 KNDLLDYLRSLTPEK 258 K+ L + ++LT EK Sbjct: 110 KDRLTEANKTLTSEK 124
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 417,481,405 Number of Sequences: 1247039 Number of extensions: 8901098 Number of successful extensions: 30321 Number of sequences better than 10.0: 248 Number of HSP's better than 10.0 without gapping: 28432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30188 length of database: 397,579,747 effective HSP length: 115 effective length of database: 254,170,262 effective search space used: 16775237292 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)