Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1039725406-023673-12484 Query= (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1039725406-023673-12484
Query= (420 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,247,039 sequences; 397,579,747 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|16930529|gb|AAL31950.1| CDH1-D [Gallus gallus] 70 2e-22 gi|23480590|gb|EAA17111.1| hypothetical protein [Plasmodium... 40 6e-09 gi|20849968|ref|XP_151126.1| hypothetical protein XP_151126... 54 3e-07 gi|25032350|ref|XP_195981.1| hypothetical protein XP_195981... 54 3e-07 gi|20915805|ref|XP_159532.1| hypothetical protein XP_159532... 54 3e-07 gi|25031628|ref|XP_195928.1| hypothetical protein XP_195928... 50 6e-06 gi|23479822|gb|EAA16551.1| hypothetical protein [Plasmodium... 38 0.030 gi|6274552|ref|NP_009330.1| signal transducer and activator... 32 2.1 gi|422969|pir||A46159 interferon-dependent positive-acting ... 32 2.1 gi|129074|sp|P21258|OGL_ERWCH OLIGOGALACTURONATE LYASE >gi|... 31 2.8 gi|7517337|pir||B72581 hypothetical protein APES063 - Aerop... 30 4.7 gi|23482833|gb|EAA18699.1| hypothetical protein [Plasmodium... 30 6.2 Alignments
Score E Sequences producing significant alignments: (bits) Value gi|16930529|gb|AAL31950.1| CDH1-D [Gallus gallus] 70 2e-22 gi|23480590|gb|EAA17111.1| hypothetical protein [Plasmodium... 40 6e-09 gi|20849968|ref|XP_151126.1| hypothetical protein XP_151126... 54 3e-07 gi|25032350|ref|XP_195981.1| hypothetical protein XP_195981... 54 3e-07 gi|20915805|ref|XP_159532.1| hypothetical protein XP_159532... 54 3e-07 gi|25031628|ref|XP_195928.1| hypothetical protein XP_195928... 50 6e-06 gi|23479822|gb|EAA16551.1| hypothetical protein [Plasmodium... 38 0.030 gi|6274552|ref|NP_009330.1| signal transducer and activator... 32 2.1 gi|422969|pir||A46159 interferon-dependent positive-acting ... 32 2.1 gi|129074|sp|P21258|OGL_ERWCH OLIGOGALACTURONATE LYASE >gi|... 31 2.8 gi|7517337|pir||B72581 hypothetical protein APES063 - Aerop... 30 4.7 gi|23482833|gb|EAA18699.1| hypothetical protein [Plasmodium... 30 6.2
>gi|16930529|gb|AAL31950.1| CDH1-D [Gallus gallus] Length = 451 Score = 69.7 bits (169), Expect(2) = 2e-22 Identities = 44/81 (54%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Frame = +3 Query: 162 CSARAAQNI*GHHRPVIASNFRGLNGHSPSKKLAAEGWL-RIAS*QAEVSFVNGINQTNR 338 CS R +Q G RPVIA + R H K++ R+ S A VSFV GINQTNR Sbjct: 365 CSPRTSQ---GRDRPVIAQS-RVAERHLSLKEVGRRPLGGRVTSKHARVSFVIGINQTNR 420 Query: 339 STN*ERPCTTTHRIKKELSVC 401 STN ERPCTTTH I+KELS C Sbjct: 421 STNKERPCTTTHGIEKELSTC 441
Score = 55.5 bits (132), Expect(2) = 2e-22 Identities = 32/60 (53%), Positives = 36/60 (60%) Frame = +2 Query: 2 QRTGM*STRADDSRLLGIPR*RPTIAMIYPHHDEISQDYPGLSAKAIYSLNTSV*RACGP 181 QR G STRA D LLGIPR IA+ PHH+ S YP L AK + L+ SV RAC P Sbjct: 308 QRAGTYSTRAYDPHLLGIPRSWGIIAIPDPHHEWGSTGYPRLPAKGTHKLSQSVQRACSP 367
>gi|23480590|gb|EAA17111.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 402 Score = 39.7 bits (91), Expect(3) = 6e-09 Identities = 15/21 (71%), Positives = 20/21 (95%) Frame = +2 Query: 338 LHQLRTAMHHHP*NQERALSL 400 +H+L+TAMHHHP NQERA++L Sbjct: 177 IHELKTAMHHHPRNQERAINL 197
Score = 36.6 bits (83), Expect(3) = 6e-09 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +1 Query: 52 HSSLKTNNCNDLSPSR*NFPRLPGPVGQGYILVEYI----SVARVRPRTSKGITDLL 210 HSS K NNCN+LSPSR Y+L++ VARV+P +K T LL Sbjct: 87 HSSFKINNCNNLSPSR-------------YVLIKITFTISVVARVQPTLNKVDTSLL 130
Score = 22.7 bits (47), Expect(3) = 6e-09 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +3 Query: 300 EVSFVNGINQTN 335 ++SFV GINQTN Sbjct: 164 KISFVIGINQTN 175
>gi|20849968|ref|XP_151126.1| hypothetical protein XP_151126 [Mus musculus] Length = 136 Score = 54.3 bits (129), Expect = 3e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 331 QIAPPTKNGHAPPPIESRKSSQSVNPCYV 417 QIAPPTKNGHAPPP ESRKS QSVNP V Sbjct: 13 QIAPPTKNGHAPPPTESRKSYQSVNPVRV 41
>gi|25032350|ref|XP_195981.1| hypothetical protein XP_195981 [Mus musculus] gi|25046121|ref|XP_195957.1| hypothetical protein XP_195957 [Mus musculus] Length = 44 Score = 54.3 bits (129), Expect = 3e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 331 QIAPPTKNGHAPPPIESRKSSQSVNPCYV 417 QIAPPTKNGHAPPP ESRKS QSVNP V Sbjct: 13 QIAPPTKNGHAPPPTESRKSYQSVNPVRV 41
>gi|20915805|ref|XP_159532.1| hypothetical protein XP_159532 [Mus musculus] Length = 98 Score = 54.3 bits (129), Expect = 3e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 331 QIAPPTKNGHAPPPIESRKSSQSVNPCYV 417 QIAPPTKNGHAPPP ESRKS QSVNP V Sbjct: 13 QIAPPTKNGHAPPPTESRKSYQSVNPVRV 41
>gi|25031628|ref|XP_195928.1| hypothetical protein XP_195928 [Mus musculus] Length = 44 Score = 50.1 bits (118), Expect = 6e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +1 Query: 331 QIAPPTKNGHAPPPIESRKSSQSVNPCYV 417 QIAPP+KNGHAPPP E RKS QSVNP V Sbjct: 13 QIAPPSKNGHAPPPTEWRKSYQSVNPVRV 41
>gi|23479822|gb|EAA16551.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 115 Score = 37.7 bits (86), Expect = 0.030 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +1 Query: 43 LTRHSSLKTNNCNDLSPSR 99 LTRHSS K NNCN+LSPSR Sbjct: 2 LTRHSSFKINNCNNLSPSR 20
>gi|6274552|ref|NP_009330.1| signal transducer and activator of transcription 1 isoform alpha; signal transducer and activator of transcription-1; signal transducer and activator of transcription 1, 91kD; transcription factor ISGF-3; transcription factor ISGF-3 components p91/p84 [Homo sapiens] gi|2507413|sp|P42224|STA1_HUMAN Signal transducer and activator of transcription 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) gi|2281071|gb|AAB64012.1| transcription factor ISGF-3 [Homo sapiens] Length = 750 Score = 31.6 bits (70), Expect = 2.1 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 115 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 222 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>gi|422969|pir||A46159 interferon-dependent positive-acting transcription factor ISGF-3 91K chain - human Length = 739 Score = 31.6 bits (70), Expect = 2.1 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 115 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 222 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 682 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 716
>gi|129074|sp|P21258|OGL_ERWCH OLIGOGALACTURONATE LYASE gi|78268|pir||JQ0189 oligogalacturonide lyase (EC 4.2.2.6) - Erwinia chrysanthemi gi|148426|gb|AAA24825.1| oligogalacturonate lysase (ogl) Length = 388 Score = 31.2 bits (69), Expect = 2.8 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +3 Query: 216 SNFRGLNGHSPSKKLAAEGWLRIAS*QAEVSFVNGINQTNRSTN*ERPCTTTHRIKKELS 395 SN R + H+P + E W+ S A VS++ G TNR P T +R E+ Sbjct: 226 SNMRKVKEHAPGESCTHEFWVPNGSALAYVSYLKG--STNRFICSVDPVTLENRQLTEMP 283 Query: 396 VCQSLL 413 C L+ Sbjct: 284 PCSHLM 289
>gi|7517337|pir||B72581 hypothetical protein APES063 - Aeropyrum pernix (strain K1) gi|5105622|dbj|BAA80935.1| 64aa long hypothetical protein [Aeropyrum pernix] Length = 64 Score = 30.4 bits (67), Expect = 4.7 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 89 DRSLQLLVFNEECLVSASHQLALTTSL 9 DR LQL + N E LV+A H A+ TSL Sbjct: 23 DRGLQLALVNVESLVTARHHRAVNTSL 49
>gi|23482833|gb|EAA18699.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 78 Score = 30.0 bits (66), Expect = 6.2 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 335 ICLVNSVNERDLSLLTS 285 ICLVNS NERDL+LL S Sbjct: 2 ICLVNSDNERDLNLLIS 18
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Dec 9, 2002 8:40 PM Number of letters in database: 397,579,747 Number of sequences in database: 1,247,039 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 300,766,433 Number of Sequences: 1247039 Number of extensions: 5637668 Number of successful extensions: 11544 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 11315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11544 length of database: 397,579,747 effective HSP length: 115 effective length of database: 254,170,262 effective search space used: 6100086288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)